Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "adobe"
-
BOSS: That icon is not centered, move it slightly to the right
ME: You're wrong, I can garantee you it's centered (it was centered)
BOSS: Well, my eyes are telling me it's not, so move it to the right
ME: (faking increasing margin)
ME: Ok, now it's 10 px to the right, what do you think?
BOSS: it's a great result, now it's perfect! Cant you see the difference?
ME: Absolutely, you do are the real designer here...
BOSS: Ohhh, stop complaining, you'll learn one day...
ME: Yep.18 -
Github education: You get a bunch of cool free stuff if you are a student.
Intellij: You get all of their IDEs for free if you are a student.
Adobe: You get a discount but you still have to pay 20€ per month as a student.
This is why I love programming and the whole community around it.11 -
Try to open a new PDF. Adobe says it must restart. I click OK, figuring it just needs to restart the reader itself.
Reboots entire computer instead... For a PDF reader update...
Uninstall time!13 -
My experience with Adobe...
(I recently moved to Canada)
Me: I want to give you money. (Tries to pay with Canadian card)
Adobe: Sorry, you have a US account, you must use a US card.
Me: Okay, what are my options to pay with my Canadian card?
Adobe: We have to delete your US account and create a Canadian one.
Me: Okay... Why can't you just switch the country from US to Canada on my account?
Adobe: *bullcrap response*
Me: Okay, delete it and transfer everything.
*Kicks me out of the chat.
*I log back in. Try to reconnect to customer service chat.
Adobe: AdobeID unable to participate in chat.
*I'm 30 minutes into this ordeal
Me: (to myself) I could literally torrent this program in 5 minutes 🤔
Lesson: if a company wants people to not torrent their software make it easier for a willing fucking customer to buy your software!
Since the chat doesn't work anymore, I called customer service and am still on hold.... 😤😤😤
Why does the internet have borders?10 -
How to secure yourself from flash 0-day attacks:
1. Uninstall flash
2. Don't reinstall flash
3. Seriously, you don't need flash8 -
Dude comes for an interview for a mobile position - one of the first things he says is "Adobe is killing Flash, don't know why, big mistake."7
-
I just love it when my coworkers talk (troll) about Google Ultron like it's the answer for everything in front of a new dev and he's getting more and more confused thinking "what's this awesome Google product I've never heard about"
And we just know that within the next 30 minutes he will have tears in his eyes of laughing after reading the story and probably also has it 'installed' (like some other devs) on his desktop (http://imgur.com/gallery/W9Pnh)
Have a good chuckle if you haven't read it before:
http://imgur.com/gallery/iJD8f
http://imgur.com/a/AOz0d
Don't forget to download your adobe reader guys.
7 -
Many, many years ago, Apple had this software you could install which allowed you to take full control of someone else's machine. Well, my mate who was a designer worked in a different office downstairs. I was often in their fixing stupid shit problems. While he was out on lunch, i installed and configured the software on his mac. After lunch I went back upstairs and watched his every move on my mac. He was in adobe inDesign creating some design for a brochure. He was in a text box changing the heading, i seized the opportunity and took control typing in the text box "i am a useless cunt", pissing myself, I then selected the text and increased the size and made it bold... then the phone rang.2
-
Regular day at Adobe:
Intern: Sir, I have created this amazing functionality that will make user's life easy. Shall I push it for review?
Manager: Did you say it will make their life easy?
Intern: Yes Sir!
Manager: Can we fire this intern already?
Adobe, seriously man make up your goddamn mind. Why the fuck are you taking away useful features and making them hidden under hundreds of icons you have. This is so fraustrating 😡7 -
Modern web developer Stater pack
1.Mac with 100 stickers on it
2.Love linux but never used it
3.Border 0px
4.Border radius 2.7px
5.sketch+adobe22 -
Thanks Adobe for the such clear icons, I really appreciate your use of descriptive symbols (one is for "view full page", the other is for "activate single page view").
8 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
199$ for game maker studio
Naaa i will just use godot thx
1000$ for 3dx max
Naa will just use blender 3d
899$ for Fl studio
We have lmms
Sublime text 70$
Vscode is better.. i will just use that
Adobe illustrator 19$ a month
Nice try we have Gravit Designer25 -
What is AI?
CS student: Artificial intelligence
Graphics Designer: Adobe Illustrator
Biology student: Anthro Insertion
Pervert: Anal Intercourse
Lesson: be careful with your abbreviations2 -
"You can't run Slack, Premiere, After Effects AND Photoshop at the same time with only 8 GB RAM!"
Me:
-
Wish Adobe would take a similar approach like Microsoft and release their Applications for Linux.. so I could use Photoshop and Lightroom there and ditch OS X completely...10
-
Hi this isnt actually a rant this is the girlfriend speaking (or typing hihi) i just wanna say how interesting this platform is. Bye 😊👋🏼26
-
The best part of being an university student?
- Microsoft Imagine
- Office 365 for free
- GitHub Student Developer Pack
- JetBrains Product Pack for Students
- Spotify for only €4.99/month (instead of €9.99)
- Discounts for tech products
And if you're lucky also Adobe CC and AutoCAD.
The worst part?
- The university14 -
It's a shame that Adobe doesn't support Linux for their creative suit. I know lots of artists and designers that don't use Linux regularly because of this, since Photoshop and illustrator are the de facto tools for their work. Adobe xd seems to be awesome, but I can't use on my pc due the lack of support -.-21
-
my company just paid adobe to use pirated copy of adobe software ,arrested one emp.
Multinational company -_-
listed company -_-
premium product -_-
why the hell they can't pay money to deserve one?
writing this rant on pirated windows.7 -
Requires windows 10 anniversary or later... So let use photo's that show it installing on vista...
Well done Adobe.
9 -
Sometimes I think back to all the funny shit that happened and how simple stuff fucks everyone
- tired Database engineer deleting (not dropping, literally rm -rf) the database files on the wrong server
- Microsoft delivering viruses through updates
- Pissed and stubborn dev deleting his one line library repo which does something like removing a char left side of string fucking an unmeasurable amount of other projects
- Adobe getting hacked and exposed for storing passwords in plain texts
- a doubled line causing a bug called heartbleed in a fuckton of webservers
- a Tutorial Company getting kicked from github because their repo got so big github staff had to maintain the repo manually
- and an old one: bad code crashed a space shuttle16 -
"To use the clock you need Adobe Flash"
Really 1&1? You really need flash to show a fucking clock? Its not that hard to do this in javascript, or? Even if it is an analog clock :D There is even a tutorial of the "quality content page" w3schools about implementing this in javascript ... just whyyyyyyy? it 2018, not 2004.
(1&1 is an german ISP. This message occured in their webmailer using it without flash.)
6 -
My personal android app project started at android 1.5 and actually went to google play when android 4.2 was launched... With the look and feel of android 1.5...
Prior to that I spent about 2 years trying to make an Adobe Air app out of it.
I feel proud of my perseverance. -
A person just bought a 3000€ workstation and asked me to install cracked versions of Office, AutoCAD, full Adobe suite and Rhino with plugins. And he's going to use them at work to make money.
So, since I have to, I installed 2-3 years old versions of each, in English (he only knows Italian) and blocked all the connections so he can't receive any update/fix or use web related functionalities. I also disabled all autostarting components and contextual menu / OS integrations (although this can be seen as a plus).
When he's calling me asking to "fix" things, I will simply say "sorry, it's the only way for the crack to work, if you want everything you'd better pay for a license or else go open source".
Why can't people understand the value of the complex software they use? Just because it's not a material thing doesn't mean it's not a steal42 -
Wohoo! Adobe kills flash in 2020 👍
"Adobe chose to end Flash because it believes coding technologies like HTML5, WebGL, and WebAssembly "
http://fortune.com/2017/07/...3 -
I can get absolutely dead pissed by the fact that a FUCKING 1800 euro laptop can't do a fucking basic thing like connecting to a bloody WiFi ap?
so why, you wonder? oh no, the problem isn't the fucking hardware. IT'S THIS DEAD BEAT PIECE OF SHIT CALLED WINDOWS. mfw when it runs fine under Linux, BUT WE CANT HAVE NICE THINGS CAN WE ADOBE?!?8 -
The new figma plugins are actually insane lol, some examples:
- font scale, always struggled with having to apply the formula myself or finding the right one so it scales nicely
- image tracer, that plugin replaces adobe illustrator for me, since I only used it to convert pixels to vector images
- removebg, 99% of what I pulled photoshop up for
still have to test them some more, but so far it literally replaces all that adobe crap for me.
https://figma.com/c/plugin/...
https://figma.com/c/plugin/...
https://figma.com/c/plugin/...
6 -
i also started learning adobe illustrator a few weeks ago :D
joke/meme adobe illustrator net c# graphic design junior developer power pose female developer lowpoly8 -
I always liked doing interesting things with adobe tools, but today I've found a video from 2013, where I am 14. I have no idea how I did it.
5 -
My Dream Job?
✅ 100% Remote Work.
✅ No dogshit Proprietary Stacks like Adobe Experience Manager.
✅ Reasonable Timelines.
✅ Management defers all technical decisions to you.
✅ Actually Challenging Projects.
These are my Big 54 -
Just clean installed windows few days ago and my laptop is already mess again. Anyone else with same problem? 😂 I Suck at managing stuffs.
19 -
FRIENDLY REMINDER: Fucking save your goddamn work. Thanks.
- Your friendly neighborhood dumbass who just lost 14 hours of his life because his computer crashed.
P.S. Normally not a problem when working on code because I'm forced to save and commit with Git. Unfortunately I was balls deep in Adobe motherfucking illustrator working on wireframes, and didn't have doc recovery turned on.6 -
Adobe will end-of-life Flash by 2020, and all big Browsers are joining this by disabling Flash features slowly
Let's make a petition to end-of-life Electron, it is basically Flash for Desktops and it is A RESOURCE-HUNGRY LAZINESS-PROMOTING PIECE OF SHIT THAT SHOULD IMMEDIATELY BE REMOVED FROM THIS VERY PLAnet.. what do you think about that particular idea?
#StopElectron2017smhOkayAtLeastBy2020Please22 -
I SWEAR TO FUCK IF ADOBE CANT GET THEIR SHIT TOGETHER
WHY CANT AFTER EFFECTS LOAD AUDIO LONGER THAN 4 MINUTES
WHY DOES IT SILENCE THE AUDIO PAST THAT POINT
WHY DOES IT NOT NOTIFY YOU THAT IT WILL SILENCE THE AUDIO
IM GOING TO STRANGLE SOMEONE6 -
Next task list of an Adobe developer:
1. Fuck something up so that the user has to google for the simplest possible functionality.2 -
After spending around 8+ hours on an Adobe After Effects project (which I obviously didn't save), at around 12 at night, it crashed.
I lost everything. Was heartbroken. Died inside. Nearly cried. Then I restarted the app and started from scratch.
The weird thing is I recreated the entire thing in around 1.5 hours. Not sure if I'm happy or sad with myself.4 -
!Rant
Designer decide to have a meeting with stakeholders about UX/UI workflow for control panel of our new embedded system (no framework, no library, gui is bit per bit rendered on frame buffer).
A week later, still nothing on my table, not a mail, not a call. Meanwhile I wrote a framework, the control system, renderer, and messaging queues between tasks.
Wrote some widgets, a layout system and a view swtching mechanism, and a separate stack control to use a "back" button.
Now I am stuck for I do not know what should happen when clicking on various (non obvious) items on the touchscreen.
Fine, I'll ask the designer.
"Oh, I will write the workflow next week" (ETA time, 2 weeks. Seriously? You take a week to draw on Adobe Illustrator 20 screenshot with text and I have another week to write it from scratch in C?)
Ok, while you write it, just tell me what should happen when I click an active item.
"Well, we didn't talk about that. We just decided the colour of the icons on the screen..."
For fuck sake...8 -
Adobe is predatory. I bought a subscription to Adobe Premier four months ago. After using it a little, I found Davinci Resolve (it's free) and decided it was just as capable for my needs. Upon trying to cancel Adobe, it offered me 3 more months at a good price and I thought, well, maybe I could still use it for some other things. But that didn't turn out to be true or necessary. I went to cancel today at the end of the 3 months and it said I would have to pay $94 for cancelation. I guess the fine print was too fine for my 49-year-old eyes or I wouldn't have signed up for that 3-month extension. I got on live chat with their AI, figured out how to get a real person, and began negotiating. They tried to sell me a lower cancelation fee. No. I don't want any fee. They tried to sell me other products at a lower price. I didn't need any other products. Finally, I used a little reverse psychology and said "Fine, I'll keep it. You win, I guess. Just tell me when I can cancel something I'm not using and won't be using and without being punished with a fee."
Apparently, that unlocked something in the Indian guy's call flow script and he offered to waive the fee. Just needed a moment to converse with his manager and get approval. That's 20 minutes of my life and billable time I'll never get back.3 -
https://blogs.adobe.com/conversatio...
Adobe Flash Player will officially die in 2020.
No more updates. If there'is a security bug, it remain.30 -
@Apple iPadOS an iOS teams: you puZies.
You release one buggy iOS / iPadOS after another, each piling on features and bugs, without fixing crowd documented long standing defects.
But what really pisses me off is when you don't have the balls to own up to your mistakes. This is at least the 3rd time you have re-released an iOS / iPadOS update under the same version number. This time it is 14.5.1
I have iPadOS 14.5.1 installed and the iPad is now telling me I need to update to 14.5.1. Just own up to it, you released buggy shit and you need to release another bug fix days after... call it 14.5.2. Call it like it is and we respect you. Try to hide it and you lose our respect, you pussies.
If Microsoft did one thing right, they defined the release sequencing:
X.Y.Z
Changing X means rewrite the manual it is so new and improved (🖕🏻 you Adobe and FileMaker)
Changing Y means it is an update with more features than bug fixes but not a generational change that constitutes a rewrite of anything (🖕🏻 you macOS team for bastardizing with 10.X.Y)
Changing Z means you fixed your stuff, we respect you for owning up to your mistakes.
Man-up Apple, grow some balls and stop confusing people with trying to cover up your screw ups. It's all about the Z.3 -
I once found a MongoDB cluster open to the internet with no authentication with nearly a terabyte of data that backed a CRM service whose customers included Microsoft and Adobe to name a few.7
-
When the design agency changes the whole fucking UI 1 week before release because they think the usability is not good enough.
FUCK YOU YOU FUCKING PLACENTA EATING LOBOTOMIZED ADOBE FRANKENSTEINS2 -
If Adobe would just release their products on Linux I would literally have no reason to ever use Windows again...11
-
Serious considering wiping the Windows 10 partition on my computer.
Only thing keeping me from doing it is the Adobe Suite. Damn it.
If only they made it for Linux, life would be such a blessing.
P.S. : GIMP is not a replacement.16 -
nvidia makes me sick, nvidia fucks with my kernel, nvidia earned a place in hell, nvidia is shit, nvidia runs like garbage stuffed in to my motherboard, nvidia is so expensive, nvidia made my work harder and that's not what computers are meant to, nvidia's website sucks, nvidia has no solutions if you're running on GNU/Linux, nvidia owes me money, time and tons of coffee, nvidia is so much a pain in my ass.
nvidia is now on my shitlist, just before apple, followed by adobe.17 -
Flash has made Java programs look desirable. And anyone keeping up with me knows I despise Java and C#, despite having written C# and currently working on deciphering a Java server to create documentation.
Before I begin, I want to make this clear: IT IS TWO THOUSAND AND FUCKING EIGHTEEN. 2018. WE HAVE BETTER TECH. JAVASCRIPT HAS TAKEN OVER THIS BITCH. So, firstly, FUCK FLASH. Seriously, that shit's a security liability. If you work for a company that uses it, find a new job and then fucking quit, or go mutany and get several devs to begin a JS-based implementation that has the same functionality. There is no excuse. "I'm fired?" That's not an excuse - if there is a way to stop the madness, then fucking hit the brakes on that shit or begin job hunting. Oh, and all you PMs who are reading this and have mandated or helped someone else to mandate work on an enterprise flash program, FUCK YOU. You are part of the problem.
The reason for this outburst seems unreasonable until you realize the hell I went through today. At my University, there is a basic entry-level psychology course I'm taking. Pearson, a company I already fucking hate for some of the ethically sketchy shit they pulled with PARCC as well as overreach in publishing to the point they produce state tests here in the US - has a product called "My PsychLab" and from here on out, I'm referring to it as MPL. MPL has an issue - it is entirely fucking Flash. Homework assignments, the textbook, FUCKING EVERYTHING. So, because of that, you need to waste time finding a browser that works. Now let me remind all of you that just because something SHOULD WORK does NOT mean that it actually does.
I'm sitting on my Antergos box a few days ago: Chromium and Firefox won't load Flash. I don't know why, and don't care to find out. NPAPI and whatnot are deprecated but should still run in a limited mode or some shit. No go on Antergos.
So, today I went to the lab in the desolated basement of an old building which is where it's usually empty except a student hired by the university to make sure nobody fucks things up. I decided - because y'all know I fuckin' hate this - to try Windows. No go in Chrome still - it loaded Flash but couldn't download the content. So I tried Firefox - which worked. My hopes were up, but not too long - because there was no way to input. The window had buttons and shit - but they were COMPLETELY UNRESPONSIVE.
So the homework is also Flash-based. It's all due by 1/31/18 - FOUR CHAPTERS AND THE ACCOMPANYING HOMEWORK - which I believe is Tuesday, and the University bookstore is closed both Saturday and Sunday. No way to get a physical copy of the book. And I have other classes - this isn't the only one.
Also, the copyright on the program was 2017 - so whoever modded or maintained that Flash code - FUCK YOU AND THE IRRESPONSIBLE SHIT YOUR TEAM PULLED. FUCK THE SUPERIORS MAKING DECISIONS AS WELL. Yeah, you guys have deadlines? So do the end users, and when you have to jump through hoops only to realize you're fucked? That's a failure of management and a failure of a product.
How many people are gonna hate me for this? Haters gonna hate, and I'm past the point of caring.6 -
Photoshop in my country with a low dollar exchange rate, literally required 1/10th of my monthly salary when I was a beginner.
Literally go fuck yourself Adobe.3 -
I just wanted to watch that video! who on EARTH still uses adobe flash player! seriously can anyone tell me?
7 -
!rant
My first design work (in Adobe XD)
Design has never been my strong point (implementation or design) but am very interested in designing interfaces.
Don't hold your horses. Criticize this. I want to know what you think about this.
16 -
Boss: We should use Adobe ColdFusion for our next project
Me: Why?
Boss: Because it's the only programming language that can generate PDF. In our next project we will be generating a lot of PDF receipts on daily basis
Me: Oh no!2 -
This drawing was commented on my PR to explain the flow of a bug I need to fix, what da fuck does this means. I already told him to use a mock up tool like Adobe XD or some shit like that. Dudes answer's was "It's easier for me just to draw it"
12 -
Ok, which idiot at jetBrains thought it was a good idea to have "CRTL + Y" be a "cut line" (instead of redo) and "CRTL + SHIFT + F6" be "rename" (instead of just simply "F2")...
And also, which idiot thought it was a good idea to not allow us to properly change it (doing so will result in the right shortcuts doing nothing at all)...
Fuck you and your "Adobe-style" shortcuts.
Minor edit: Some idiot decided that it'd be a good idea to *only* have a custom rename shortcut work *if* I already grabbed my mouse, right-clicked the file/folder and hover refactor...
Might as fucking well continue my mouse-movement and click "rename" you fucking morons.13 -
Took me a few hours, but managed to finally run Adobe Photoshop CC 2018 on my old school Toshiba laptop running Arch Linux xD Still needs some work, but super happy I got it running :D
14 -
Received screen designs for a new website in Adobe Illustrator format with all the measurements in centimetres.3
-
A few weeks ago a client came to us asking for edits on their site. They had a developer in their office but they fired him a few days prior. After some looking at the piece of garbage they called a website I told my supervisors that it was built in Adobe Muse and from what I could find in a few quick searches it's shit and I didn't want to learn to use a shit tool. Apparently as a company we decided to hire a freelancer to handle this despite the fact that we didn't build the site and the client isn't paying for maintenance so I'm not sure why it's our fault.
Fast forward to today:
I've been in the office for 19 hours straight trying to learn how to use Muse and fix the client's site because somehow the freelancer managed to delete the mobile version of the site. When I ask my supervisors why I'm fixing and supporting a site we didn't build and don't have experience working in and the response is: we're presenting the client with a $50k proposal and we need all the good graces we can get.
Unless I'm gonna see some of the commission it doesn't really matter what we charge for the site, I make the same whether it's a free site or a $100k site.2 -
fuck iText.
fuck Aspose.
fuck Adobe.
fuck PDFs.
It will be all too soon if I never have anything to do with programming an app to do PDF generation/manipulation ever again.8 -
Little news for fellow Linux users and Windows users who want to switch.
WINE 3.0 has been released recently and I haven't seen anyone mention it here so I thought I'd share. It features support for Direct3D 11.
https://winehq.org/news/2018011801
http://omgubuntu.co.uk/2018/01/...
Also, apparently, Photoshop CC 2018 works: https://imgur.com/a/k0HI07 -
This fucking Adobe piece of shite.
I get it, you probably make one of the best editing software available out there. But if you could stop rearranging all the icons and features in your UI, that would be fucking great so that I don't have to search on the internet for hours to find out a simple feature.3 -
It grinds my gears to no end as to how insanely BAD most Electrical engineering software is. Lets start with Tina. A circuit simulator. A few versions ago it was rather good but now it feel like its built upon more legacy crap than fucking Windows! This causes it to have memory access violations and crashes even when you look at it from an odd angle.
On topic of circuit simulation. LT-Spice! It has less errors than Tina but is impossible to use without being lobotomized first. Who the FUCK decided it was a good idea to reinvent keyboard shortcuts by movin all of them to the F-row at the top of the keyboard. Also there is no option to delete a component. YOU NEED TO USE CUT IN ORDER TO REMOVE IT!
And at last Altium Designer for Layouting and Schematics. Whose license costs 9 grand. No one outside of some companies will buy this because of the price. Altium realized this and made two watered down versions of it. Which dont really get updates anymore. (last one was in 2018) So they essentially made a cash grab from people who cant afford their actual product. There also exist other (and a lot cheaper) products than what Altium offers. The problem is that they dont work well with interoperability. Schematics drawn in one program will look distorted in another or not import at all. And since Altium is the industry standard you got yourself this nice steaming soup of impossible collaboration. Its kinda like Adobe being absolute shit at progressing their software just because they got no competition. Or rather they do but the industry wont switch cause adobe is so engraved into it.6 -
Adobe, who the fuck told you to put an icon on the desktop? Knock that shit off, no one wants to open Acrobat XD from the fucking desktop.6
-
Joined a new project and started messing with the application...Greeted with a blank web page and a pop-up **please enable flash**1
-
!rant
I’m a backend - spaghetti - developer, and today i took the biggest mindfuck in my life when i found out that it’s possible to have functional mockups... at first glance i tought that i’ve only received a screenshot collection of what the designer did... guess what... i was able to click lè buttons and go trough the whole application flow.
Thanks Adobe for xD ...
I should get a freakin designer job.3 -
New company issued desktop is running win7 *criiiiiinge*
Solution: run linux on VirtualBox!
Efficiency++
Productivity++2 -
VsCode.
I have been on a journey with editors, all the way back to using edit.exe in Windows 95, to notepad, MS FrontPage, Adobe Dreamweaver, PHPDesigner, vim, nano, then out to Eclipse, Atom, Brackets, notepad++, back to Atom, then VsCode.
And by far, vsCode has given me the most productivity and customisation of them all to not care about what project I open, what language it's written in, or what frameworks are working behind it. I can switch with workspaces and everything is setup to go, yes it's a pain in the ass to setup, but it's a ducking dream to just open and jump in.
Now being able to use VsCode for Salesforce has dropped any requirement for me to keep eclipse around.rant wk206 solves my problems productivity++ multiple everything. multiple languages vscode multiple git hosts1 -
I'm a dev and I like to rant
And who says it has to always be about Dev stuff ?
So!!! I ve spent 2 days as a junior dev and I feeel not well... 1) I am the worst dev in the company with no experience 2) brain-dead 3) feel like I wasted 2 days and learnt nothing, I guess in theory it's something but realistically I had no "it clicked" /pure genius /astounded myself / made major new brain connections moments
So what's going to happen now. ? When will I wake up? How do I wake up ?11 -
In my classes whatsapp group
*posts a ppt*
person 1:how do I open it?
person 2:use adobe reader
me:*bangs head in the wall*1 -
I. HATE. DELL. WITH. MY. GUTS.
Their low tiers products are full black plastic overpriced fuckshit, if you press too much the cover you can actually destroy your display. Fuck shitty laptops and fuck this shitty laptop in particular. It's slow. It's so slooooooow. It's everflying fucking slow motion, being on the web is like being in the matrix while dodging bullets made of wordpress plugins. The only good thing I can say is that is living right now, it has been... Three years? I only picked it because of high discount and ubuntu preinstalled (that made me think: oh, maybe they have components that are linux compatible regardless of distros. It was not). I'm enjoying Manjaro, when I'll have the skillz i'm going full Arch.
I will start university this fall. It's going to be a math major. I absolutely need something better than this anyway. I am also freaking out because I don't know which genre of software they could want to make me install and if they're windows/mac only. In the meanwhile I do photography, video, design and as you may suppose Adobe is often my go-to; I also have to build a workstation at home. I am freaking out because WELL FUCK WINDOWS 10 AND ITS PRIVACY NIGHTMARE PERIOD.
Which laptop I buy?
How well does heavy software run in a Windows virtual machine (on the desktop, not the laptop)?10 -
Please just let me cancel my 1-year subscription for the end of that one year NOW without only giving me an option to cancel everything right now and still pay 54 € fee, that's not only silly, it's what makes customers shout FUCK YOU Adobe! Long gone the good old times, who needs your outdated stuff in 2022 anyway?5
-
Because in #Adobe's utopia world, #everyone is a local admin.. and is super computer literate and knows how to use the terminal to change permissions. Oh wait no, the fact is the world is filled with organisations whose users act like monkeys in a cage and absolutely cannot be trusted with admin rights.
And yes.. the 'repair' does nothing, of course!
Ughhh Adobe.. get your act together.
-
So I was planning on a single page website for my relatives hotel websitte and offered to make it for free ( as an offer for other huge project i was doing for same person )
But just got told that one of my uncle told to tell me that website design should like the website design of another hotel xyz.
For second, I thought that other would be very nice. So I checked it out.
Guess what! That other site looks like it hasn't updated since 2005! No HTTPS. No responsive design. Looks like fugly crap from 2005 to me. Has a huge Click to enable Adobe Flash banner on homepage.
I lost my hope in humanity and I quoted a price for making that. I guess I just gotta do a shit job and will get paid for it now 😂2 -
I work 3 PM to 1 AM as a daily office job. Then go home and try to learn programming. Wake up next day at 8:30 AM for kind of another work until 1PM. Doesn't pay as much but I have to try. Then if I get free time do some freelance on UPWORK with whatever little graphic designing I know to help pay the bills.
And the fact that even my laptop is dying is a huge blow. Don't know when it might give up. Has 1st gen core i5 dual core, takes ages to load Adobe softwares. I have wanted to hulksmash this shit, but can't.
If I'm lucky, I get a stress free 6 hours of sleep a few days a month. And my depression doesn't help. More sleep should ease me a little, but I can't afford to waste any time. But this is life, isn't it.3 -
So to un install Premie Pro I first need to sign in to my Adobe account, to then fucking update Creative Cloud, and then, then I can remove the garbage. Or so I hope ffs...2
-
Nothing like good old Adobe flash on Windows 2000 to keep air lines on time... Oh wait, what? Their computer system crashed again? Oh well, never mind :(
8 -
I recently joined to a company. I am recent grad. I was getting KT by my Manager during team on-boarding.
The manager showed me the tech stack they use for the application. It had the given logo.
My manager read it like this - "We also use Adobe here ....."
I muted my mic and laughed so hard, and now I am searching for jobs at some better company- where managers don't confuse AngularJS logo with Adobe.
7 -
Does anybudy still use Adobe Animate/Flash for web animations?
They teach it at my school and at the moment I see no reason to use it. I'm probaly faster writing it by hand in CSS / JS, and it will run smoother that the animate files...6 -
Okay so i graduated last year and got a job working for a place that sadly disappoints me in their web development practices. This place uses a dead technology(my opinion)called Cold Fusion by Adobe. They do not use any form of version control like Git and their sites are very shitty and the design and development is implemented very poorly honestly. It honestly makes me sad that i feel like im smarter than my department vp. That being said i do not feel challenged here and am looking to collaborate in some open source projects via Github preferably.I dont consider myself an expert in this field but i would say im about intermediate level in web development. Im pretty comfortable with HTML,CSS/SASS,PHP,JS/JQuery, and im pretty comfortable in the PHP framework Laravel. So if anyone is interested in collaborating or starting something up, id be so down for it. :)5
-
Designer using Adobe Muse can output html. says to me... "Sorry. It looks like I've taken your job" oh dear.3
-
Adobe labs released one new component, I played with it after two days. Went to an interview with huge company after two weeks for a developer position, the interviewers was from different departments, they asked about one technical challenge they have, then I suggest the new component as solution, they gave me small task to implement using the component, I delivered it next day... Then they hired me in R&D department. It was great days.
-
I was flash developer once, it was great when macromedia was around, then adobe acquired them, now flash is gone.
Years are passing and most of industry is the same as always. Trying to drag you into this rat race of learning new amazing technologies, amazing projects that are actually doing same job as 50 years ago but using more memory and cpu cycles. Because all has it’s roots in algorithms from previous centuries.
So youngsters loose your best life time, be innovative by doing nothing more then copy paste from stackoverflow and duck typing shitty code.
Be a slave and sit in the amazing office, that has everything but not your real life that meanwhile is sucked by corporate squeezer till your last breath.
Be piece of shit that can be kicked around.
Watch youtube, facebook, instagram or whatever social network that shows you pictures that are fooling your mind that you’re someone special and you need this stuff.
Then be ready to suck some dicks to earn money and buy stuff you don’t need, live where you don’t want and do what you don’t like. You piece of shit.
Well that’s what disappoints me from my tech stack.
Now chill out, turn off your electronic gadgets, go out and enjoy real world.1 -
So I heard this story from my boss,
Boss: you applied to the open web developer job?
"Pro": yes i have designed many websites.
Boss: are you good with css?
"Pro": Yes i am really good with adobe Cs(6). -
So I was working on a website for a club in my college. I designed a pretty decent UI and at first everyone accepted it. So I made a working website with my friend, made backend with node and all was set.
After that, the fucking member of club brought in another graphic designer for changes. And they literally made the whole website with heavy images. The designer made heavy neon backgrounds in Adobe Illustrator and didn't even compressed it.
They made the whole fucking website with images and they ran it all on localhost and were happy with the speeds! ಠ_ಠ
They even put an image in fucking Navbar!
And then I left that project, I could not see more destruction.1 -
I guess I can also amend in my long, ongoing, storied history of bad calls, failed projections and stellar forecasting that:
- I invested an embarrassing amount of time, money and hope learning Adobe AIR
- I've sent-away for the https://inventhelp.com patent registration kit at least twice
- I've publicly declared that OAuth would never last
- I actually thought Microsoft was onto something with J++
- I bought a bunch of shares of World Wrestling Federation stock the day it went public
- I've stated on my movie podcast that I'll defend until my last breath my argument that Godfather III may be the best film in the series
Can I pick 'em, or what? ;)
---
Part 1 of my bad calls: https://devrant.com/rants/2786266/...
10 -
Since the last Windows Update broke my wife's laptop (the WiFi driver doesn't woro anymore) she's moving to Linux. I hope it goes well since she is a non-techi. I kinda am excited.
The biggest problem will be the lack of Adobe Illustrator. 😕14 -
Apple, next time you want to get me to upgrade my file system, please FUCKING TELL ME IT WONT LET ME INSTALL WINDOWS USING BOOTCAMP, 9 hours and I’ve only just found the file system that will let me run Adobe Cloud and Windows
-
Just remembering that time (years ago) at my old job when my then boss asked our 3-man team to develop an Adobe Flash multi-level beat-em-up game with customisable characters and computer AI in 6 weeks, only for the one asshole comment on Youtube to label it "aburido" (boring)
"https://youtube.com/watch/..."
4 -
We don't have a designer yet in the team so we had to learn Adobe XD on the side to prototype our ideas. After months of getting the hang of it thinking this semi-free tool will work for us to save some money, Adobe decides to change their pricing plans starting in April 2020 and it will no longer be free. It feels like Adobe trapped us to get used to their platform and then secretly slap us with a price tag halfway. We can't blame them since we're all trying to put food on the table here. We started exploring Figma today and oh boy was it a gift from the gods! The features are so much better. They make our workflow faster!3
-
I was pretty upset at my loved one today. She asks me how to save a file into a PDF, so I explained how to print to PDF from chrome, pretty simple, good so far. Then...
-"Hey, the file has an 'e' for internet, will they need internet to open the file?"
-No, why would they?
-The file has an 'e'
-Did you name it 'e'?
-No, but it has an 'e' like internet
-... You mean the icon?
-Yes
-Right click, click on properties and change the default program to Adobe...
-Oh God, it's so complicated, I'll ask someone else to do it
-What? It's literally 2 clicks!
-Why does it need internet?
-It doesn't! It's just the default
-The what?
-Cheez! Doesnt matter, just go to properties and click on 'Change'
-Fine! Done now what?... Ooh...
-Now click on Adobe Acrobat
-Awesome! Thanks! Now it's fixed, I'm so glad because I'm about to send it on an email and I'm sure my boss would have thrown a fit if they weren't able to open it offline
-😒4 -
Adobe's ExtendScript toolkit is abyssmal. I find posts from 2008 referring to issues that have not changed even in CC2017. Do you think they are small issues I'm bitching about? I'll list 2. First, the toolkit only colours "var, return, for, foreach" and a bit more keywords and the strings, of course you can set up color schemes but those are limited and not colouring stuff. The second issue is auto-complete, it rarely kicks in and suggestions have 0 connection to what are you doing and are always the same. It doesn't recognize anything of what are you doing.
Probably in 2008 you had to program with the manual near you like writing assembler, now there's an improvement in 2017, they got a window named object browser or something like that that actually is a summarised portable manual that could've been easily transformed in auto-complete suggestions.
Adobe writes about this and I quote: "a complete integrated development environment". Although I will not write much scripts in it, I need to write a big one and thought about extracting that object data and putting it in a more capable javascript editor. LO and Behold what I discovered, the ExtendScript Toolkit that's supposed to edit Extended javascript and save it as jsx or jsxbin is almost completely (it has some dlls too) built using around 100 jsx files. It's the equivalent of building a js IDE to edit js.
Sorry for formatting, I'm on mobile, I tried.
-
Adobe Creative Cloud: "Sign In Required".
I don't have Photoshop, XD, or any Adobe product open.
No "close window" button in dialog.
My choices are "Continue" or "Sign In Now".
Errrrrrrgggggghhhh...1 -
Graphic & Web Designer
(job offer)
- graphical proposals for:
-web pages,
- banners,
- presentation materials,
- gaming graphic,
- application (iOS, Android) graphic...
Bla bla bla...
Min. 2 years profesional experience...
Valid certification and lvl of proficiency in (Adobe Photoshop, I lnDesign, Illustrator)...
Fast delivery....
Salary 3,50€ brutto / hr 🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣....
Jobs in Slovakia 🤣6 -
In a recent venture, I had to use an office suite and a photo editing software regularly. As a Linux user, I tried using Libreoffice and gimp. But that was just a mess. My other project partners were using MS office. Format, image alignments, fonts.. everything was messed up. Same happened wih the gimp. I know Photoshop, learnt while studying. Gimp was just no match to that. I was forced to go back to Windows. And I was surprised that the latest MS office and Adobe Creative Cloud were excellent. MS office was smoother and faster than Libreoffice.
I love linux. I have tried all the major distros and I love all of them. But I would still say that Linux is not the best option for day to day non-dev tasks. Whatever Richard Stallman and the Open Source Community say, Linux lack good softwares, at least some good document, photo, audio and video editing softwares.8 -
If you ever think your job or stack absolutely suck ass.
Just remember there's someone still working with ColdFusion in 2023.
6 -
New toy for frontend devs:
OpenType 1.8 Variable Fonts.
1 font file to rule them all. Manipulate on the fly fluidly the font weight via css and javascript.
http://blog.typekit.com/2016/09/...
1 -
We're both senior devs, I use nodeJS/Python. Stop forcing your Java *superiority* shit on me. I can write the API using either language. Also fuck your JVM. FUCK THAT SHIT4
-
So in the context, I ragequitted my school at the end of the 4th year (out of 5, so no diploma). I was broken, poor (the only money I got was my parents), and mad as fuck.
I took a 2 month vacation during the summer where I did strictly nothing, then I sat down to my computer, opened Rubymine and started building my new website (current version actually, new one is in progress)
Right after that, I downloaded the trial version of Adobe InDesign and created a better / updated version of my old CV, and put it on LinkedIn, Viadeo, everywhere. At first, it didn't work much since all my experience was about underpaid internships, so I honestly had no work experience on the paper.
Then, while answering to a job offer, I put my CV on Monster, before I realized I should have done this from the beginning: next 3 mornings I had 5 phone calls, and 2 appointments per day for 2 weeks 😁😁
My current job was one of the firsts that called me, but made me wait a whole month (through appointments & shit) before answering me "Yes" one tuesday at 10 pm, on my way to take a shower. It's been 10 months now 😁2 -
go fuck yourself with your fucking communities. i went into computing because i like being left alone. who are all those fucking freaks building their communities? this is capitalism mother fuckers, everybody in the world agreed on it, on each person being an independent individual doing their job to the best possible standard, instead these low-skill low-iq oversocialised sheeple started conglomerate into communities and brainwash everybody that this is what it is about. get stuffed alright. all my life i've been introverted, just leave me alone to write code alright? take my library i don't mind i'll take yours no strings attached, just push the code and forget about it. but no, all these degenerate morons without CS degrees have occupied our safe space, pushed us out of it and just can't get enough of using the buzzword "community-driven" "volunteers" volunteer my ass assholes you can't even make software nobody in real industry needs you because you have no skill at all you learn a bit of js which is any 14-15 yo can do and now think you're some kind of prodigies, unsung heros of humanity who selflessly bring the progress. nothing can be further from the truth - because of you we don't have real software, we don't have investment we don't get no respect everybody walks all over software engineers treating us like shit, there's an entire generation of indoctrinated parasitic scum that believes that software tools is grown for them on trees by some development teams that their are entitled to automatically, because some corporation will eventually support those big projects - yeah does it really happen though - look at svelte, the guy is getting 50k a year when he should be earning at least 500k if he had balls to start a real businesses, but no we are all fucking prostitutes, just slaving away for the army of people we never see. are you out of your mind. this shit should be fucking illegal alright it's modern day slavery innit bruh, if a company wants to pay their engineers to work on open source this is fine, i love open source like java or google closure compiler, but it's real software made by real engineers, but who are all these community freaks who can't spend a 10 seconds on stage in their shitty bogus conferences without ringing the "community" buzzer? you're not my community i fucking hate your guts you're all such dumb womenless imbeciles who justify their lack of social skill by telling themselves that you're doing good by doing open source in your free time - mate nobody gives a shit alrite? don't you want money sex power? you've destroyed everything that was good about good olde open source when it was actually fun, today young people are coerced into slavery at industrial scale, it's literally impossible to make a buck from software as indie unless you build something really big and good, and you can't build anything big without investment and who invests in software nowadays? all the ai "entrepreneurs" are getting fucking golden rained with cash while i have to ask for a 5$ donation? what the actual fuck? who sanctions this? the entire industry is in one collective psychotic delusion, spurred by microsoft who use this army of useful idiots to eliminate all hounour dignity of the profession, drive the abundance and bring about poverty of mind, character, as well as wallet as the natural state of things. fucking amatures of course you love your shitty little communities because you can't achieve anything on your own. you literally have no personality, just one homogenous blob of dumb degenerates who think and act all the same. there used to be a tool called adobe flash builder, i could just buy it, then open and make a web app, all from start to finish in one program, using tutorials of adobe experts on youtube, sure it might have had its pitfals but it was a product - today there's literally no fucking product to make websites. do you people get it? i can't buy a tool that i need to do my job and have to insult myself by downloading some shitty scripts from some shitty unemployed devs and hope my computer doesn't blow up in my face in the process because some freak went off his nut and uploaded some dodgy ass exploit on npm in his package. i really don't like. it's not supposed to be like that. good for me i build by own front/back end. this "community" insanity is just a symptom of industrial degeneration, they try to sell it to us like it's the "bright" communist future but things never been worst, i can't give a shit about functional programming alright i just need to get my job done mate leave me alone you add functional because you don't know how to solve the problem properly, e.g., again adobe flex had mxml where elements had ids and i could just program to id, it was alright but today all this unqualified morons filled the whole space after flash blew up and adobe execs axed flash builder instead of adapting it to js runtime, it was a crime against humanity that set us back to 1000s4
-
As a teenager learning to code on a computer given by my parents
It hurts to see announcements like mobile development has some limitations on 32bit, or Github Desktop, Adobe XD and the new Unity only supports 64bit6 -
"For front end developers that don't like Sketch". Say what!? Sketch is the best thing that's happened to front end designers in terms of design tools. Anyone who prefers Photoshop to Sketch is a sadomasochistic.1
-
Got our snazzy new HP Elitebooks from IT. Nice lil laptops.
Guess how many apps they installed for us off the list of "Applications Devs Need" that was submitted with the original request that they asked us to provide.
Goddamn 0. 0 Apps installed. ”Instead here is admin access, install what you want.”
Being a PC guy I don't mind setting up a new environment but things like Office365 and Adobe CC could of been installed for me, I don't have the licence info offhand so now I gotta bug IT again and why ask for a list if your not going to install any of them?? Ugh. I don't have time to sit here while Adobe installs the whole suite....
/rant
What's the first thing you install on your new PC? I find I grab ConEMU first.6 -
Around the time Apple was denouncing it, I joined a chatroom for Adobe flash game developers. I really loved the idea of making games too, so I tried to learn ActionScript3. That failed, because it was my first language and since I was broke, I couldn't afford flash pro, so I was using an open source ide with okay documentation, but no newbie coder tutorials. I didn't actually start learning to code till Codecademy came out, I learned js, then I learned visual basic and Java for online courses the local community college had available, and now I'm taking C, C++, Java, and Python in college while I use C# at work and JS during my free time. Sadly, in a jack of all trades, master of none :/1
-
If you need workarounds and tricks to make your computer obey you, your operating system is trash. MacOS, Windows, I’m looking at you. This is indisputable.
Instead of defending that crap, just admit it. You did nothing wrong. You was forced to use it, because I understand that not every piece of software can run on Linux. Perhaps you earn money using Photoshop or any other Adobe software. There’s nothing wrong with it. You don’t become a baby-eating trash supporter billyboy if you’re just using an OS.
Perhaps you like macOS UI better than KDE or Epiphany. There’s nothing wrong with it either.
But please don’t defend trash just because you use it for one reason or another. Admit it to yourself and say “yes, the OS I use is a piece of crap that doesn’t respect users, but right now I’m forced to use it because of the software I make a living with”. This is the only non-traumatic way to start defending your rights.
Peace7 -
I told my boss that Adobe ColdFusion will cost us 8k for Enterprise license. He said that he will look for the free license key (pirated) online tonight.
I feel sorry for the developers of Adobe ColdFusion.
Related Link:
https://devrant.com/rants/1515286/...3 -
My dad was using notepad to edit some HTML for his website. I downloaded Visual Studio Code and he likes it SO MUCH MORE. (I wonder why....).
Kinda happy I could help him with it. He is pretty good at coding but just hasn't done it in a while (not his trade) so he doesn't know all the new tools and such.3 -
Just boosted my Starling/Adobe AIR game engine's performance by 60%! active code time per frame @ 60fps reduced from 50% to 19%. Now I have more room for lighting effects :)
-
Html5 vs Adobe flash. Html5 won
Html5 vs java Web embedded app. Html5 won
Therefore Html5 vs java 3 billion devices. Ans=?5 -
Top Tip!
I just found out about http://figma.com a collaborative design tool, looks a bit like a mix of Sketch and Adobe XD, but with real collaborative features AND as far as I know it's FREE! :O and has both mac and Windows apps , AMAZING6 -
It's amazing how companies like Autodesk and Adobe see Linux as some "toy". When we talk about Linux we are talking about a professional workstation. My entire company uses Linux (currently Fedora 39) on its workstations, and all of our servers use FreeBSD. Not because it's free, but because it proves to be better than the alternatives to what we produce. We pay for licenses for JetBrains, BricsCAD, MATLAB and I still happily pay STEAM to play my Civilization, Doom Eternal, CS2 and I use Proton to continue my adventures in Diablo and Star Craft, all PAID. Adobe and Autodesk, be ashamed and instead of talking about market share, admit that you do not have competence.7
-
Doing personal online shopping whilst waiting for code to compile (took about 10-15 min every time, just for the smallest code change).
This was a really slow Adobe Flex system which I hated. Actually glad I left because no sane company uses Flash, even in 2012. -
I was waiting in a queue for Adobe support for over an hour, decided to go for a smoke. I come back, and a representative had entered the chat and closed it because I didn't reply within like 2 minutes ... FU
-
Bloody ColdFusion. I hate it so much. Not only is it an inferior language. Also, every update breaks something. Adobe should have sticked with developing graphics packages like Photoshop and Illustrator, because they really suck at everything else.5
-
ColdFusion is a bag full of pure, manure-reeking stupidity.
For example, some functions, like arrayIsDefined, return YES or NO - instead of true or false. I'm not kidding. Adobe == fucking lamers ? YES : NO. Definitely YES.5 -
Competition is necessary for a healthy marketplace.
Whenever there is a monopoly or a near-monopoly, its owners can treat their users poorly through restrictions (Android OS becoming like iOS), planned obsolescence, unfounded content takedowns (YouTube), account lock-outs until the user provides more personal data (Google demanding phone numbers), subscription services instead of ownership (Adobe, BMW heated seats), and users would have nowhere else to go.1 -
I just think about it ...
Running docker on windows is shit
Running nginix on windows is boofff
Running apache on windows is boofff
Running WWS on windows is hugly
Install linux
All server software run like king
Don't have access to any adobe product for design and micro$hit office for client sanity because ODF is to special, i want my docx i said ... Like what do you want from me ... Shit the dev setup is a fucking mess because some enterprises don't want to wet itself in the futur...
Microsoft love linux BULLSHIT6 -
You know something has gone wrong terribly when no MS Office program or Adobe reader starts while the debugger is waiting at a breakpoint.
I'm really curious which part of the kernel or system near userspace-components can cause such behaviour and where MS created pointless tunnels between independet software to let that happen. But I think I will never find out. -
I regret downloading too many Photoshop brushes, gradients, actions, patterns & etc.
Purging files at the moment.1 -
Being drunk I keep thinking I can't get back the years I didn't spend programming when I was 16-20. What do now? Want to do Web but all I know is a micro part of everything. I can make a demo in old Unity. I have shitty basic skills in Java, Python, Pascal, JS + React. Also basic UX, Adobe design programs like AI, PS and ID. Nothing proper, and home projects just don't seem to cut it. Irl bards can't get no work4
-
BRO HONESLY I JUS WANNA PLAY WHACK YOUR BOSS BUT NOOOOOOOOOO I HAVE TO A STUPID ADOBE FLASH PLAYER...........WHOOOOO TF HASA3
-
Is it just me, or do Adobe products just get progressively harder to use? I'm thoroughly frustrated with trying to figure out how to do simple things like annotating screenshots in Photoshop, like I used to do several versions ago. All these damn options and non-intuitive names for things and crap scattered all over the UI. I just want to draw a friggin arrow and wrap red text in a nice box with a white background!!!
-
Two months in my new job, no task assigned to me yet. Not even one. There's been a budget reallocation, and the team just got dissolved. Will probably be moved to a new team (or not?). Part of me enjoys the free time I'm getting (I get to work on my side projects) but it's kind of depressing that I can't prove to the company how much I love building things while at the same time helping the company. 😔4
-
My presentation looks unappealing (LaTex magic) and apparently due to Adobe stuff, videos on overleaf don't play.
So, I have the choice of moving to another format (google slides of M$ powerpoint) by tomorrow, or switch between the media player and the presentation slides.
Both look... More unappealing than my presentation. 😒🙄😤7 -
Fuck Adobe Premier.... after 2 days of trying to get it to stabilize a video n prolly frying my CPU.... I'm moving to Plan B.... guess it should've been Plan A:
Upload Youtube so I can use their Video Editor... then download it back when it's done.6 -
Got a code for the Adobe suite which made it the same price as the student package so i could use PS for a tiny project and to dick around a little bit: mostly to see what has changed since CS5. Project was done in 2 weeks and I didn't open PS again for months, letting my subscription lapse too. Well if your subscription lapses Adobe deletes all of it's apps from your machine with no fucking notice. Pretty fucked when you are out in the sticks with shit internet and limited bandwidth, not to mention the ethical shitfuckery of it. So I tried to cancel my subscription, but because the deal i got using the discount thingy there is no button to cancel like there normally is and tech support tell you that you can BUY OUT OF YOUR CONTRACT by paying ~60% of the yearly cost upfront. I told them to fuck themselves and 30 mins later had the subscription canceled.
Am I the only one that sees anything wrong with all this??6 -
Fuck Magento 2 and it's useless documentation. Fuck it for deprecating straightforward stuff for the reason of being to complicated with the warning that the functionality will be removed and then replacing it with a way more complex solution, while internally just using the deprecated stuff and laughing external developers in their face.
Fuck Magento, fuck Adobe.
Just had to say that.... -
Do these stupid tech writers even research what they talk about, if it's not the same 5 points as every other article on the topic then it's an article written this week on '5 Open Source HTML and CSS Editors and they mention Brackets.
Fair enough... but they link to the adobe Gitub, saying it ""isn’t super actively maintained"" which I guess is accurate since it has been dead for 2 years. Rather than the more recently updated 'brackets-cont' project that had a release back in October 2022.
Like fuck it's like these tech writers just pump out content years after it's relevant without any research or editing.
Pointless complaining I know but it bothers me how mindless mainstream tech writing is, it's all the same regurgitated ideas, or outdated information. Not saying I could fix it, but I'm sure someone out there can do something.1 -
Idk why but this morning I was thinking about this high school elective class where we learned Adobe flash. But specifically 2 instances where I ignored the teacher and did my own thing
1. We were using Sprite sheets and he had us use photoshop to cut out the Sprite to a different layer and manually save each Sprite one by one to disk to use in flash. Some sheets had 50 fucking sprites
So I found a script for Adobe (action script I think they called their Javascript derivative) that exported every layer for me without all the manual clicking. There is probably an even better way. But this worked for how lazy I was back then
2. Our final projects we could do anything but he suggested not doing anything too complicated cause of time constraints and he barely taught is the scrptinh language for Adobe flash so making flash games was almost out of the question.
Me being stupid really wanted to make a working pong game. So I spent too long watching a German (i dont know German) tutorial video I found, and troubleshooting outdated code from that video. And improving things where I could with my limited knowledge made worse cause I wasn't interested in programming and didn't start learning python until the following year
Yeah don't know why I was thinking about those. But I feel it's a good perspective on how far I've come. From hacking together a pong clone with no skills, to being hired to automate and optimize processes and legacy projects -
I can't fucking read adobe *eks deh* ever as what they intended it to be, it always seems like the author of the comment / .. is a gen Z laughing out loud about something.6
-
I find adobe website fucked up. They asking to many personal information just for downloading a fucking trial software. Dude WTF?2
-
Is someone else into photography and can recommend me some Opensource software for it. (fuck Adobe for Flash and not supporting Linux)13
-
That moment when you're opening Adobe Illustrator and Photoshop as an Developer...
I really need an Designer and/or more Money for this shit.4 -
I just tried to download Photoshop CC. On Linux. Just to give it a try in Wine 3.0 and see if it works.
Adobe rejected my humble request with "Your operating system is not supported."
Ok.
I switched my user-agent to Windows and voila, it tried to give me a dmg installer.
A. Fucking. Mac. Installer.
WHAT AM I SUPPOSED DO TO WITH THAT ADOBE YOU STUPID CUNT!9 -
Used to work salary and in-house for client but now do freelance for them ‘cause ‘rona.
Adobe CC and Font Suitcase licenses are due for renewal and they want to cancel them for all but essential in-house senior staff.
I tell them I have both at home, on my own dime, but I need their font folder to be able to use them.
So I have 12,000 fonts now.1 -
Adobe XD is the newest terrible child of the idea that you can design "user experience." What a waste of time. How many more middle-men do we need in this work flow?4
-
One of top clients, a Designing firm started asking for non-programmer jobs like office templates.
Client sends in .indd and .ai files.
Me: Requests for psd version as I lack tools for .indd and .ai
Cient replied: "I am not used to being asked for png’s to be made when I provided you with an AI file for all logos. I do expect you guys to use a little bit of nouse / imagination and work out that you can create the png yourself from the a.i. file provided. This is something no other programmer asks me to do."
Me: U for real? Why would a developer like me have Adobe Indesign installed in my machine?
pfft.1 -
I hate it when designers just LOVE to use blend mode multiply everywhere, and the client is looking at the website in IE asking why it's not the same as design.
-
Worst one was in my first ever web developer job. It was a small company where everything was done in Adobe ColdFusion. Was there for 2.5 years before they went bankrupt and I got made redundant.
So when it came to look for another job, I was hoping to get another ColdFusion related job. But a lot of company's requirements were pretty bullshit. Junior position, but must have 5 years experience.
After 4 months of looking, eventually found another job but as a PHP developer. But since my PHP skills were beginner's level, I had to start from a new graduate level salary all over again. Felt like the past 2.5 years at my first job was a waste of time. -
Running Adobe Flash Builder IDE for creating Flex application really sucks..!
VS Code work better nowdays for many languages...!
Support for ActionScript is quite with extensions.5 -
Been running windows in a virtualbox on my Ubuntu cause folks at Adobe didn't think Linux users were important enough ugghhhh8
-
Recovering a Raid 1 EXT4 disk to a ZFS disk. Thank god for Adobe programs and their multi million file-based caching files.
recovery_time.add(4.hours) -
My company design floor plan and some photoshop work for clients.
One project was to resize the image to certain width and height and place it in the center of the photo with padding 40px around.
I wrote an extended script of Adobe to help the design department and process thousand of images within an hour.
My Boss was so impressed and have a meeting with me. He said: "You need to lead IT department and create a system that can detect the client's requirement and complete the drawing with Adobe Illustrator automatically".
Me: Thinking (Meh, I have no knowledge of Image Processing with my poor Mathematics, where can I die with his requirements?) -
Okay, I've been thinking on this all week.
Microsoft Office (All of it)
itunes
Adobe Creative Cloud (Only The Management Software / Installer)
Apple Mail -
I haven't checked figma plugins much since their announcement, but holy shit scrolling through the list now is nuts, they have so much goodies, open source, things you had to pop into adobe illustrator first too.3
-
So this one is more for web devs out there, but is Adobe Experience Manager as popular in the enterprise works as my boss claims? I've never heard of it getting used much, and I don't hear about it in web development circles.2
-
I wonder what impact the launch of Affinity Publisher will have on Adobe, now that their core creative suite has been re-imagined by Affinity. Ive been using the beta and it pisses on inDesign. Good work Affinity !
-
Install Adobe suit and your internet will be fucked off. The solution is to find all startup items of com.adobe.* and remove them. I don't understand why they put their files across all system. Adobe: please be normal and act normal. It's 21 century.2
-
So many changes over the past few months. Transitioning from a freelance logo / print / packaging designer. Going full stack web developer. Even switched from adobe CC to Sketch for my design needs. What a ride. Everything I come across is new territory. I’m like a newborn baby. The struggle.
-
Adobe Cloud got my computer messed up and it couldn't even be uninstalled! I got so p-o I went to the registry and nuked anything containing the word "adobe" in it. Pheeew, what a relief! Like taking a real good dump! My computer both starts and runs faster now, and without popups requesting me to log in to Adobe Cloud.
-
Ok so I had to make a revision on a PDF with JS that was being tested to fix some bugs, I hadn't touched it or Acrobat Reader for more than a month I think but I could work on it well back then.
I had to see the problem first so when I go and open it with Adobe Reader, it crashes. Weird. I can't get it to work.
Well I'm reinstalling it then.
After downloading the (now correct, I tried to use an old one I had and lost some time) installer, I tried to install it and it asked me to close Outlook and Excel. Weirder.
I do, and after finishing it said "you have a newer version, open it?". Super weird. Of course when I accepted it didn't work.
I uninstall my current installation and while uninstalling it asks me to close Chrome. Ok now I'm not ok with this shit.
Adobe wtf?
I needed to fix it in some minutes and it ended up taking hours.4 -
As a junior in a print communication agency, my boss wanted me to make their portfolio.
Their requirements were: a full animated flash website (in 2010...). Understand, they had been bought the Adobe license...
After several months of works and ton of alerts about flash death, the website has been deployed.
My boss did not understand why he could not visit the website with its iPhone...
The website had lived 2 months and will was replaced by a static "wix" alternative... So much work for nothing because the boss did not trust a junior dev.
Biggest lesson: Always begin with fast proof of concept to validate your hypotheses for you and for your boss ;) -
There are two good ways to approach binary app distribution:
1. Every app has its own installer, shell-based or otherwise, that handles everything including choosing the right binary, downloading it, managing versions, updates, config files, etc — all of it.
2. Every app is distributed as source code. It's user's responsibility to build it by the guide provided in README and keep it updated.
In between those two pillars, there is an uncanny valley of orphaned dependency graphs, broken post-install scripts, vendor-locked enforced app stores, eCoSyStEmS of apps, Adobe Creative Cloud, and all the other shit.6 -
The fact that affinity designer,photo is better than Adobe illustrator , Photoshop affinity is killing the game1
-
This is the first project that I remember. There were probably others before it, but nothing really stands out before this.
My buddy and I got an Independent Study together in high school. Our goal was to write a video game. We harbored no illusions that it was going to be the best game ever or anything, it was supposed to be a project that taught us enough to move on to something else later.
Our chosen tool for this endeavor was Flash 4.0, back before Adobe bought Flash. I don't know why we thought it would be a good idea to do this. I think it was because we could let Flash handle all the graphical stuff and we could focus on the behavioral side.
I don't really remember much about how the project turned out other than we both learned a lot about what not to do.
Luckily, the teacher overseeing our Independent Study felt that the lessons learned were more important than the product, so we got high marks. -
Hi there everyone am Shreyas a CS student. Am a C# guy and learn the parts of language every day (recently learning Asp.net) and having a lot of intrest, knowledge and passion in buildling stuff in it with WPF, Xamarin. And also i do practice a lot in it everyday.
But recently I am getting a lot more intrest in UI/UX designing. Am finding myself watching more UI/UX designing (mostly in Adobe Xd and illustrator) videos on YT (dansky YouTube channel specifically) rather than C# which I used to watch in early days.
So what is your suggestion on it? Should I learn the UI/UX designing basics. Will it help me in future, if I become a developer on building applications for mobile and desktop in C#?
Am pretty confused with it? Should I learn it or not?2 -
I am trying to fix my magento broken modules since last week still stuck ... The documentation sucks for Adobe Magento... 😪😪1
-
Are any of you "cursed" with a particular set of software tools/programs?
Take me for example, I cannot use Adobe shit or it crashes. The same thing can be said for Microsoft Office. Anything in there, it does not matter. It always crashes on me. I continuously get the "Not responding" status. Regardless of operating system.
This has made me absolutely *despise* anything that is Microsoft Office or from Adobe. Now, I am sure you can all guess how and during what circumstances I would have to touch Microsoft stuff, work and the like.
But Adobe, mainly photoshop because it is what my designer uses for mockups and the sort. Dude has been constantly baffled when I show him me trying to open something only for it to crash. And we have made the experiment, in which two of my other employees would use MY COMPUTER to open something in Adobe and it would not crash on them. But the fucking moment I attempt to open anything in these two pieces of shit, guess what? it crashes.
I fkn hate Office and Adobe products4 -
I'd bring back ActionScript 3, make sure it is supported in all environments including iPhones, make swf files lighter in size, make adobe air a popular platform, basically I'd do everything to bring back AS3, even make it open sourced, so that Adobe doesn't make all the money.
-
Why is it so difficult to tell the people to not use the same passwords everywhere? I thought of a service which searches all leaked databases and predicts a password based on that as a warning for the user... Having the program told you that your password the user is likely to enter would be XY, because the adobe OR MySpace OR Dropbox passwords for the email OR username entered was that password could be a bit more aggressive but useful to let the users at least think of secure passwords.1
-
Is anyone here using something like "moqups"? I found it just recently and love the idea of it all being in one place with its own project folders, but the thing that is throwing me off is the money to what you get ratio, since it would be nice to have something that combines trello+adobe xd+flowcharts and more across devices with near unlimited space.2
-
Adobe "enterprise" cms... Want access to GPS location, links to external tracking sites, adverts portals... Soooo this is what Enterprise looks like by Adobe? How come they still have the legal right to "develop" software?1
-
Internship Title : Database building
Skill(s) required: Java, PHP, HTML, CSS, JavaScript, C#, Python, SQL, Bootstamp and Adobe Flash and CCNA
Yes, you read it correct, Bootstamp
WHHHHYYYYYY ???3 -
Macromedia Authorware. Wasted 3 months of my life on a course assignment and classes for this. Shame really cuz I was hoping it would improve after Adobe took over.
-
Native Android Java/Kotlin I got covered but I need to go multi platform mobile. Your choice, why and why not?...
- React native
- Flutter
- Adobe Air
- phoneGap/Cordova
- Xamarin
- another?12 -
Long standing PhotoShop bug in Wine FIXED! It's stated that it was for CS5, but I've heard one report that it's also fixed a CC version, but not sure if it was the latest CC or not. I don't miss much from Windows, but the Adobe workflow is one thing I do miss. Possibly the ONLY thing I miss at this point. https://bugs.winehq.org/show_bug.cg...
Has anyone got around to trying this yet? Maybe I can test tomorrow and report back!14 -
This is for the swedish: I saw a while ago a dialog in Adobe Acrobat where the title was: "Närmaste nerladdning chef". (~"Closest downloading boss")
Probably auto translated from "Closest downloading manager" -
When you work with a client who will only use Fireworks for graphics but you only have one dying old machine with a licensed copy and Adobe won't give you keys even though you bought them years ago (and can prove it!) and you can't buy new keys because they don't sell them and even if we had them we can't download it any more.
WTF Adobe!! It's a dead product! We don't want support or anything. Just give us the feckin' keys and the bloody installer!!4 -
Brackets: https://github.com/adobe/brackets
Ok this one have been bought by adobe but its source are still freely available and you dont have to pay a premium for the full feature.
I really love that editor because of the interface, i mean there is tons of editor and this one is not the lightweighter nor the fastest (in particular on opening). But it is still nice to write code with it and i dont feel like i am torturing myself every time i write a piece of js code.1 -
! Rant
Gimp and Inkscape vs Adobe
I don't want to make people angry, but maybe one day I'll be able to go back to numeric painting a little. So I was wondering what is the problem with Gimp, Inkscape and the others?13 -
I hate that I need to have Adobe Creative Cloud and its accompanying bullshit on my computer to use Adobe XD for mockups... how it intrudes on my file explorer as a shared drive... how their idea of "free" is planting a seed on my system to leech off of me in the future... how it just crashed my explorer while updating... this is why I run Linux on my laptop, why I wouldn't use Windows at all if it weren't for gaming, and why I ALWAYS use open source alternatives when they are comparable in functionality and performance. In the same sense that people don't like big government, I don't like BIG SOFTWARE.2
-
What if some one very cruel programmer programmed a programmer and designer AI that can generate code 700X faster, generate flawless and reliable code / design in any and Every programming language that could replace 100% of the programmers in the world?
What if he give it for free?
And companies started to fire all programmers and designers to download the free AI and use it and it was better than every programmer in the world?
What if the AI was able to code a whole Office suit and all Adobe products in just 3 seconds?
What if it was very intelligent that no one needs to hire a programmer ?
What if any one started to create their own app using it and replace programmers like car replaced horse?
What do you feel about it?
Do you wish if it happen?
Or not?
Is it your dream?
Or nightmare?17 -
I don't live in a vacuum. I need to open an occasional Adobe bs format file (Illustrator, Premiere, After Effects, Photoshop). An occasional MS Office file too (Access, Word, Excel, PowerPoint). And don't tell me LibreOffice supports .docx. It doesn't support edits suggestion mode well enough. I needed AutoCAD for a period of time.
Desktop Linux people, what do you want me to do? Go to devRant and post “windows bad” rant? Go cry on Reddit?
I too think Windows is evil and 11 is essentially malware, but when I suddenly need those things done yesterday, and my livelihood depends on that, I have no choice.
(this is part 2 of this rant: https://devrant.com/rants/10703825/...)13 -
Stupid Adobe Experience Manager only works in IE11.
I develop on MacBook pro.
I setup remote desktop on a windows computer at office to remote in so I can work on my MacBook remotely and deploy (manually via copy and paste into a text area called “HTML code”).
Everything is setup for the weekend.
Boom, it restarted itself and went to sleep after a Windows update...1 -
Trying to stay productive using Glyphs Mini for type design afraid to spend more $$ on something better but Adobe is very tempting.4
-
What do you guys think of the Adobe's new "Photoshop" on voice technology?
It's innovative, but I understand it's benefit other than heavy potential misuse it can used for.
See the video: https://twitter.com/ziyatong/...
RIP voice over artists and impressionists, it looks like your job is gone.1 -
My first CS class is a basic introductory C++ course. Won't even be going into OOP.
So I want to use my own laptop for the course, but I have a Mac. Thought I could use Visual Studio for Mac for the class, but turns out Visual Studio for Mac is really only for Multiplatform development with C#. Ok, then, screw that. Just wasted 20GB and an evening installing that just to uninstall it.
I'm using JetBrain's CLion for now, but apparently we'll be doing some graphics work later this semester so I'm going to need to install Windows via Bootcamp and Visual Studio there... but my SSD is too small...
I currently have Windows/Bootcamp installed on a 1TB external hard disk but that is slow af. My SSD is only 250GB and I've already used half of it for various programs I need (Adobe crap plus Logic crap cuz I make videos and music).
My only option here is to buy a new SSD but only one manufacturer sells those (OWC), and a 1TB SSD is stupid expensive, $700 almost as much as I paid for this laptop used.
So, I guess I'm just kinda deciding right now whether upgrading storage is really worth it...6 -
Spent half my day dealing with integrating an adobe captivate project with javascript into my companies "web player" for e-learning content... the lack of smartness of that program frustrates me beyond all comprehension. And because of it i had to stay late to Try and finish up a portion of the course that i had forgotten about... needless to say that i might have to go in this weekend...
-
Just 2 months after joining as contractor, now I'm UI lead (5 members in my team).
In 2 months:
I learned AEM(adobe experience manager)
Did integration of angular & AEM.
And designed architecture of application. 😎 -
//norant
I used to run linux with photoshop and illustrator on wine but I recently switched back to windows so I can run the adobe stuff natively and im using the new linux subsystem and honestly , it works pretty darn well.3 -
In high school I had a digital media class, where we mostly learned Adobe design software and video editing and whatnot, but one project was to actually code using Programming (the software) and I loved it. Later that year I used a free project in the class to learn arduino per my teachers recommendation. Absolutely loved every second of that project, and have been coding ever since.
-
Does anybody here still use dreamweaver? I used to use it a lot back in the day when I started as a designer, but haven't used it in years, but I noticed the app in our companies adobe subscription plan and have installed it.
Given that we live in an age of VS Code, sublime text and so one, I'm just wondering does anyone still use DW and if so what is it good at?2 -
I know the video editing software LightWorks has its aficionados. I can see how it's powerful. I've been using it since at least version 12. But my gosh how it screws people over. In the latest version, when you import files into a project and then want to delete _just the reference_ to the files in the project, LightWorks says "Nope, imma delete the FILE, too!" So you can never just start over with an import. When you import a bunch of still photos in one shot, no matter how many, it imports them all as an unwatchably fast 1 second video sequence instead of as an individual file. Like...what? And they've dumbed down the interface so much that there's no toolbar. You have to right-click poke at everything to try to find where stuff is. And right clicking is NON-EXISTENT on a Mac. I had to use a pen tablet to achieve it. I'm too cheap to buy Adobe Premiere for the few times I have to edit video in a year, so I guess it's just ShotCut on Windows for the rest of my life.2
-
#adobexd got a new update as they do every month and i am totally loving it.
@adobe this month got a new update and these are the things you can see now in adobexd.
➡ Free plugins :- Yeah you can add plugins to your adobe xd now using which you can do a lot of stuff like pulling avatars , building icons , getting free ilustrations and much more .
For this go to the slide menu panel on the left.
On the bottom click on plugins icon
choose anyone and install .
Really great and handy feature .
➡Another one is that you can now use subscript and superscript for your text ,thats also cool feature as well.
Ok thats it
Let me know if you have any cool plugin you like from it . >>>>
2 -
In the early days of my career, Adobe Dreamweaver was considered the top-notch and most advanced IDE. However, these days, it's rare to hear people talk about Dreamweaver.1
-
docusign signs sucks
adobe mobile sign app wount login from my app
google docs cant sign imported pdf's
wtf 😅 is everyone trying to stop me from working. i don't want to print sign and scan -
So my current company held a dev showcase last week. It was an event to show the different projects/tech stacks that different teams are working on/with. There's about 12-14 teams in our company. My team lead and I were brainstorming ideas on what to show on our booth. And I told him, I have an Intel RealSense developer kit that we can use. Anyway, fast forward to the day before the event, I was still developing our app/game for the booth. Just an emotion detector and you have to trick the app with your facial expressions. (Weird and fun, I know). The head honcho walked past the team lead and I and looked over the demo that I was playing around and he said that: "That's not work. You're wasting time again."
We were both irritated by his comments because he's one of the top dogs in the company and he surely knows about the event. Also, it's our way of showing to him that we're flexible in doing fun stuff instead of just enterprise and internal systems!
What a fucking kill joy! -
I really like Linux but it makes me mad when apps I use, like Adobe XD, are available for everything but Linux.
I'm not even going to start with HBO not being able to load streams on Linux. I payed money to stare at a black screen.
I tried to use PlayOnLinux for Adobe Creative Cloud but XD doesn't even appear there.
I also hate dual booting because when I'm using Win or Linux for a bit I tend to make different desktops for different programs/IDEs/browsers and I like them to be open at all times for easy access when I want to do shit. Dual booting means having to open all this again
VMs are even worse in that they tend to be very slow and when I see choppiness when moving windows I immediately "nope" out of that shit
I can't put up with Windows's bs anymore, but not being able to use the software I need is even worse.
I don't know what to do2 -
I'm this👌🏻close to buying affinity designer.
As someone who rarely get time to experiment with designs, Ai is just too expensive. -
Okay devs, this one caught me off guard.
I was testing out Google's NotebookLM, expecting it to be another AI summarizer. Cool, but whatever.
Instead, I found this "Studio panel" with something called Video Overview — and in less than 3 minutes, it literally turned a block of copied text and a YouTube transcript into a fully narrated explainer video with slide transitions, quotes, and everything.
No Adobe Premiere. No voiceover. Not even a script.
Check out the full video on my Youtube Channel
How it works:
You can paste copied text, link a YouTube video, or add docs
Then you hit “Generate Video Overview”
It gives you a narrated breakdown of the content
Bonus: you can customize tone, style, and export it right away
I tested it with AI tools and quantum networking stuff, and the result was clean enough to use in an actual client pitch or course video.
Maybe not perfect yet, but honestly? As someone who’s spent hours editing screencasts — I’m not complaining.
Anyone else tried this?
59 -
Adobe Illustrator worst program ever!, Need to get measurements from a webdesign and it takes for ever to load, missing images and fonts fuck this shit.
-
Hi all. I just wanted to ask you if the Bash in Windows is actually usable for web development? I used to work in Linux until recently I needed Adobe products so I had to install Windows.
I installed putty, git, svn, xampp and all, but it just feels like I just bloat the OS.1 -
Anybody fluent in Adobe Illustrator, with 30 minutes of spare time feeling unlikely generous today?
I need a tiny, tiny, tiny and simple shape/logo to be done, but my credit card is locked until next month due to previously put (by me) limit.
I can only pay in special thanks on the projects (open source) page.






































