Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "code drive"
-
"Are you familiar with uploading your code to Google Drive?"
I left the building at that exact moment.41 -
Got this from a recruiter:
We are looking for a **Senior Android Developer/Lead** at Philadelphia PA
Hiring Mode: Contract
Must have skills:
· 10-12 years mobile experience in developing Android applications
· Solid understanding of Android SDK on frameworks such as: UIKit, CoreData, CoreFoundation, Network Programming, etc.
· Good Knowledge on REST Ful API and JSON Parsing
· Good knowledge on multi-threaded environment and grand central dispatch
· Advanced object-oriented programming and knowledge of design patterns
· Ability to write clean, well-documented, object-oriented code
· Ability to work independently
· Experience with Agile Driven Development
· Up to date with the latest mobile technology and development trends
· Passion for software development- embracing every challenge with a drive to solve it
· Engaging communication skills
My response:
I am terribly sorry but I am completely not interested in working for anyone who might think that this is a job description for an Android engineer.
1. Android was released in September 2008 so finding anyone with 10 years experience now would have to be a Google engineer.
2. UIKit, CoreData, CoreFoundation are all iOS frameworks
3. Grand Central Dispatch is an iOS mechanism for multithreading and is not in Android
4. There are JSON parsing frameworks, no one does that by hand anymore
Please delete me from your emailing list.50 -
As a developer, sometimes you hammer away on some useless solo side project for a few weeks. Maybe a small game, a web interface for your home-built storage server, or an app to turn your living room lights on an off.
I often see these posts and graphs here about motivation, about a desire to conceive perfection. You want to create a self-hosted Spotify clone "but better", or you set out to make the best todo app for iOS ever written.
These rants and memes often highlight how you start with this incredible drive, how your code is perfectly clean when you begin. Then it all oscillates between states of panic and surprise, sweat, tears and euphoria, an end in a disillusioned stare at the tangled mess you created, to gather dust forever in some private repository.
Writing a physics engine from scratch was harder than you expected. You needed a lot of ugly code to get your admin panel working in Safari. Some other shiny idea came along, and you decided to bite, even though you feel a burning guilt about the ever growing pile of unfinished failures.
All I want to say is:
No time was lost.
This is how senior developers are born. You strengthen your brain, the calluses on your mind provide you with perseverance to solve problems. Even if (no, *especially* if) you gave up on your project.
Eventually, giving up is good, it's a sign of wisdom an flexibility to focus on the broader domain again.
One of the things I love about failures is how varied they tend to be, how they force you to start seeing overarching patterns.
You don't notice the things you take back from your failures, they slip back sticking to you, undetected.
You get intuitions for strengths and weaknesses in patterns. Whenever you're matching two sparse ordered indexed lists, there's this corner of your brain lighting up on how to do it efficiently. You realize it's not the ORMs which suck, it's the fundamental object-relational impedance mismatch existing in all languages which causes problems, and you feel your fingers tingling whenever you encounter its effects in the future, ready to dive in ever so slightly deeper.
You notice you can suddenly solve completely abstract data problems using the pathfinding logic from your failed game. You realize you can use vector calculations from your physics engine to compare similarities in psychological behavior. You never understood trigonometry in high school, but while building a a deficient robotic Arduino abomination it suddenly started making sense.
You're building intuitions, continuously. These intuitions are grooves which become deeper each time you encounter fundamental patterns. The more variation in environments and topics you expose yourself to, the more permanent these associations become.
Failure is inconsequential, failure even deserves respect, failure builds intuition about patterns. Every single epiphany about similarity in patterns is an incredible victory.
Please, for the love of code...
Start and fail as many projects as you can.30 -
I'm a self-taught 19-year-old programmer. Coding since 10, dropped out of high-school and got fist job at 15.
In the the early days I was extremely passionate, learning SICP, Algorithms, doing Haskell, C/C++, Rust, Assembly, writing toy compilers/interpreters, tweaking Gentoo/Arch. Even got a lambda tattoo on my arm after learning lambda-calculus and church numerals.
My first job - a company which raised $100,000 on kickstarter. The CEO was a dumb millionaire hippie, who was bored with his money, so he wanted to run a company even though he had no idea what he was doing. He used to talk about how he build our product, even tho he had 0 technical knowledge whatsoever. He was on news a few times which was pretty cringeworthy. The company had only 1 programmer (other than me) who was pretty decent.
We shipped the project, but soon we burned through kickstart money and the sales dried off. Instead of trying to aquire customers (or abandoning the project), boss kept looking for investors, which kept us afloat for an extra year.
Eventually the money dried up, and instead of closing gates, boss decreased our paychecks without our knowledge. He also converted us from full-time employees to "contractors" (also without our knowledge) so he wouldn't have to pay taxes for us. My paycheck decreased by 40% by I still stayed.
One day, I was trying to burn a USB drive, and I did "dd of=/dev/sda" instead of sdb, therefore wiping out our development server. They asked me to stay at company, but I turned in my resignation letter the next day (my highest ever post on reddit was in /r/TIFU).
Next, I found a job at a "finance" company. $50k/year as a 18-year-old. CEO was a good-looking smooth-talker who made few million bucks talking old people into giving him their retirement money.
He claimed he changed his ways, and was now trying to help average folks save money. So far I've been here 8 month and I do not see that happening. He forces me to do sketchy shit, that clearly doesn't have clients best interests in mind.
I am the only developer, and I quickly became a back-end and front-end ninja.
I switched the company infrastructure from shitty drag+drop website builder, WordPress and shitty Excel macros into a beautiful custom-written python back-end.
Little did I know, this company doesn't need a real programmer. I don't have clear requirements, I get unrealistic deadlines, and boss is too busy to even communicate what he wants from me.
Eventually I sold my soul. I switched parts of it to WordPress, because I was not given enough time to write custom code properly.
For latest project, I switched from using custom React/Material/Sass to using drag+drop TypeForms for surveys.
I used to be an extremist FLOSS Richard Stallman fanboy, but eventually I traded my morals, dreams and ideals for a paycheck. Hey, $50k is not bad, so maybe I shouldn't be complaining? :(
I got addicted to pot for 2 years. Recently I've gotten arrested, and it is honestly one of the best things that ever happened to me. Before I got arrested, I did some freelancing for a mugshot website. In un-related news, my mugshot dissapeared.
I have been sober for 2 month now, and my brain is finally coming back.
I know average developer hits a wall at around $80k, and then you have to either move into management or have your own business.
After getting sober, I realized that money isn't going to make me happy, and I don't want to manage people. I'm an old-school neck-beard hacker. My true passion is mathematics and physics. I don't want to glue bullshit libraries together.
I want to write real code, trace kernel bugs, optimize compilers. Albeit, I was boring in the wrong generation.
I've started studying real analysis, brushing up differential equations, and now trying to tackle machine learning and Neural Networks, and understanding the juicy math behind gradient descent.
I don't know what my plan is for the future, but I'll figure it out as long as I have my brain. Maybe I will continue making shitty forms and collect paycheck, while studying mathematics. Maybe I will figure out something else.
But I can't just let my brain rot while chasing money and impressing dumb bosses. If I wait until I get rich to do things I love, my brain will be too far gone at that point. I can't just sell myself out. I'm coming back to my roots.
I still feel like after experiencing industry and pot, I'm a shittier developer than I was at age 15. But my passion is slowly coming back.
Any suggestions from wise ol' neckbeards on how to proceed?32 -
Me: I use Git!
Classmates: what's that? A Softdrink?
Me: Nevermind. Just Copy the source code on gooogle drive.
Classmates: Thanks!
Me: -_-20 -
Was lead developer at a small startup, I was hiring and had a budget to add 3 new people to my team to develop a new product for the company.
Some context first and then the rant!
Candidate 1 - Amazing, a dev I worked with before who was under utilized at the previous company. Still a junior, but, she was a quick learner and eager to expand her knowledge, never an issue.
Candidate 2 - Kickass dev with back end skills and extras, he was always eager to work a bit more than what was expected. I use to send him home early to annoy him. haha!
Candidate 3 - Lets call him P.
In the interview he answers every question perfectly, he asks all the right questions and suggests some things I havent even thought of. CTO goes ahead and says we should skip the technical test and just hire the guy, his smart and knows what his talking about, I agree and we hire him. (We where a bit desperate at this stage as well.)
He comes in a week early to pick up his work laptop to get setup before he starts the next week, awesome! This guy is going to be an asset to the company, cant wait to have him join the team - The CTO at this stage is getting ready to leave the company and I will be taking over the division and need someone to take over lead position, he seems like the guys to do it.
The guys starts the next week, he comes in and the laptop we gave him is now a local server for testing and he will be working off his own laptop, no issue, we are small so needed a testing stack, but wasnt really needed since we had procedures in place for this already.
Here is where everything goes wrong!!! First day goes great... Next day he gets in early 6:30am (Nice! NO!), he absolutely smells, no stinks, of weed, not a light smell, the entire fucking office smells of weed! (I have no problem with weed, just dont make it my problem to deal with). I get called by boss and told to sort this out people are complaining! I drive to office and have a meeting with him, he says its all good he understands. (This was Friday).
Monday comes around - Get a call from Boss at 7:30am. Whole office smells like weed, please talk to P again, this cannot happen again. I drive to office again, and he again says it wont happen again, he has some issues with back pain and the weed helps.
Tuesday - Same fucking thing! And now he doesnt want to sign for the laptop("server") that was given to him, and has moved to code in the boardroom, WHERE OUR FUCKING CLIENTS WILL BE VIEWING A DEMO THAT DAY OF THE PRODUCT!! Now that whole room smells like weed, FML!
Wednesday - We send P a formal letter that he is under probation, P calls me to have a meeting. In the meeting he blames me for not understanding "new age" medicine, I ask for his doctors prescription and ask why he didnt tell me this in the interview so I could make arrangements, we dont care if you are stoned, just do good work and be considerate to your co-workers. P cant provide these and keeps ranting, I suggest he takes pain killers, he has none of it only "new age" medicine for him.
Thursday - I ask him to rather "work" from home till we can get this sorted, he comes in for code reviews for 2 weeks. I can clearly see he has no idea how the system works but is trying, I thought I will dive deeper and look at all of his code. Its a mess, nothing makes sense and 50% of it is hard coded (We are building a decentralized API for huge data sets so this makes no sense).
Friday - In code review I confront him about this, he has excuses for everything, I start asking him harder questions about the project and to explain what we are building - he goes quiet and quits on the spot with a shitty apology.
From what I could make out he was really smart when it came to theory but interpreting the theory to actual practice wasnt possible for him, probably would have been easier if he wasnt high all the time.
I hate interview code tests, but learned a valuable lesson that day! Always test for some code knowledge as well even if you hate doing it, ask the right questions and be careful who you hire! You can only bullshit for so long in coding before someone figures out that you are a fraud.15 -
Dear Misinformed idiots,
Just because you watched Silicon Valley doesn't mean you actually understand how Software Development works.
-We don't sit in front of a screen in an AC room googling funny pictures
-We don't think of new Algorithms by pretending to be jerking.
-We don't "get lucky" with our code, it takes hours of studying and research to come up with a solution which actually works.
-And we definitely can't just "create the *next* Google", THAT is not how it works.
I swear to the God ya'll love and cherish, the next person to approach me to turn their shit idea into "The next big thing", I'll leave everything aside and drive a screwdriver through your neck.
- An Engineer tired of everyone's never ending shit storm.10 -
I am currently working for a client who have all their data in Google Sheets and Drive. I had to write code to fetch that data and it's painful to query that data.
I can definitely relate with this.
PS: Their last year revenue was over US$2 Bn and one of their sibling company is among Top IT companies in the country.7 -
Worst thing you've seen another dev do? Long one, but has a happy ending.
Classic 'Dev deploys to production at 5:00PM on a Friday, and goes home.' story.
The web department was managed under the the Marketing department, so they were not required to adhere to any type of coding standards and for months we fought with them on logging. Pre-Splunk, we rolled our own logging/alerting solution and they hated being the #1 reason for phone calls/texts/emails every night.
Wanting to "get it done", 'Tony' decided to bypass the default logging and send himself an email if an exception occurred in his code.
At 5:00PM on a Friday, deploys, goes home.
Around 11:00AM on Sunday (a lot folks are still in church at this time), the VP of IS gets a call from the CEO (who does not go to church) about unable to log into his email. VP has to leave church..drive home and find out he cannot remote access the exchange server. He starts making other phone calls..forcing the entire networking department to drive in and get email back up (you can imagine not a group of happy people)
After some network-admin voodoo, by 12:00, they discover/fix the issue (know it was Tony's email that was the problem)
We find out Monday that not only did Tony deploy at 5:00 on a Friday, the deployment wasn't approved, had features no one asked for, wasn't checked into version control, and the exception during checkout cost the company over $50,000 in lost sales.
Was Tony fired? Noooo. The web is our cash cow and Tony was considered a top web developer (and he knew that), Tony decided to blame logging. While in the discovery meeting, Tony told the bosses that it wasn't his fault logging was so buggy and caused so many phone calls/texts/emails every night, if he had been trained properly, this problem could have been avoided.
Well, since I was responsible for logging, I was next in the hot seat.
For almost 30 minutes I listened to every terrible thing I had done to Tony ever since he started. I was a terrible mentor, I was mean, I was degrading, etc..etc.
Me: "Where is this coming from? I barely know Tony. We're not even in the same building. I met him once when he started, maybe saw him a couple of times in meetings."
Andrew: "Aren't you responsible for this logging fiasco?"
Me: "Good Lord no, why am I here?"
Andrew: "I'll rephrase so you'll understand, aren't you are responsible for the proper training of how developers log errors in their code? This disaster is clearly a consequence of your failure. What do you have to say for yourself?"
Me: "Nothing. Developers are responsible for their own choices. Tony made the choice to bypass our logging and send errors to himself, causing Exchange to lockup and losing sales."
Andrew: "A choice he made because he was not properly informed of the consequences? Again, that is a failure in the proper use of logging, and why you are here."
Me: "I'm done with this. Does John know I'm in here? How about you get John and you talk to him like that."
'John' was the department head at the time.
Andrew:"John, have you spoken to Tony?"
John: "Yes, and I'm very sorry and very disappointed. This won't happen again."
Me: "Um...What?"
John: "You know what. Did you even fucking talk to Tony? You just sit in your ivory tower and think your actions don't matter?"
Me: "Whoa!! What are you talking about!? My responsibility for logging stops with the work instructions. After that if Tony decides to do something else, that is on him."
John: "That is not how Tony tells it. He said he's been struggling with your logging system everyday since he's started and you've done nothing to help. This behavior ends today. We're a fucking team. Get off your damn high horse and help the little guy every once in a while."
Me: "I don't know what Tony has been telling you, but I barely know the guy. If he has been having trouble with the one line of code to log, this is the first I've heard of it."
John: "Like I said, this ends today. You are going to come up with a proper training class and learn to get out and talk to other people."
Over the next couple of weeks I become a powerpoint wizard and 'train' anyone/everyone on the proper use of logging. The one line of code to log. One line of code.
A friend 'Scott' sits close to Tony (I mean I do get out and know people) told me that Tony poured out the crocodile tears. Like cried and cried, apologizing, calling me everything but a kitchen sink,...etc. It was so bad, his manager 'Sally' was crying, her boss 'Andrew', was red in the face, when 'John' heard 'Sally' was crying, you can imagine the high levels of alpha-male 'gotta look like I'm protecting the females' hormones flowing.
Took almost another year, Tony released a change on a Friday, went home, web site crashed (losses were in the thousands of $ per minute this time), and Tony was not let back into the building on Monday (one of the best days of my life).10 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Incompetent doesn't even start to describe this one:
1. Uses Google drive instead of an online repository for code sharing
2. Uses multiple files instead of version control
3. Preferred variable names like a, a1, b, temp
4. Didn't like "wasting" space. The result was unreadable unindented code
5. Would rather use deprecated HTML tags rather than proper CSS styling
He was more like the personification of bad coding practices8 -
I really hate this company.
The code is a disaster. Every single other employee is a salesperson. Nobody has any bloody clue what I do or how difficult it is. They don't care about stability (unless things are crashing), maintenance (until crashing), code quality (until it delays features), or anything apart from shiny new features they can sell. The boss (the king salesman, if ever there was one) doesn't know how to manage, but tries to by acting like his "nice asshole" self -- he's an asshole that gives you passes, makes sure it's bloody obvious that he's doing it begrudgingly, yet everything is still absolutely your fault. If he arbitrarily decides it's too much your fault, he stops being "nice" and flips out on you in front of everyone. That's a "nice asshole": an asshole who can barely even pretend to be nice.
Fuck him.
And you know what? I really hate having to work next to these fucking birds, too.
Today was our weekly conference call, and I was both late and unprepared. I was too focused on my work, and got a ping 4 minutes into the meeting, so I obv didn't have time to prepare. Boss was also pissy today, and I didn't have much to show for my week, thanks to lots of little "OMG NEED ASAP" shit projects that all took too long, pushing back what I was actually supposed to work on. Which didn't get finished, of course, and today that project was "the most important" -- I suspect simply because it wasn't finished. AGADJFSKL. Cue the birds fucking screaming and never fucking shutting up no matter what I did. Blanket? No effect. Spray bottle? SCREAM MORE! Boss was yelling at me, the birds were screaming, and I couldn't think. Goddamn fucking disaster.
and yes, we have a macaw. A macaw and over 20 cockatiels. Said macaw decided today was a lovely day to just fucking SCREAM non-stop, and the tiels were doing their best to keep up. Thinking clearly during this cacophony? Not gonna happen.
Wait, "go elsewhere," you say? Somewhere quieter? Where is this "elsewhere?" We live in a fucking tiny house, and during the call it was (and still is) filled with sleeping people, and surrounded by a fucking desert. Who the fuck thought living in the desert was a good idea, anyway? Like, seriously. What brainless moron thought "You know what? This is a great place! Let's settle down right here," while trudging through the scorching sand and dust, looking at the basically lifeless horizon filled with large, hot, dry, dusty, barren rocks (aka "mountains"), and fucking dying from thirst? Probably someone so delirious from heatstroke they never actually recovered, and continued raving that it's a goddamn paradise to their heat-addled imbecile followers. I really hope they hallucinated a la-z-boy in place of a hedge of teddybear cholla and died an excruciating and prickly death. Fuck that guy/girl, too.
But I digress.
I seriously need an office that isn't a 30 min drive into gang-central. I'd work outside, but I live in the middle of the bloody fucking desert, and get heat exhaustion within about half an hour. Everywhere else in the house people bother me almost incessantly.
just. FUCKING FJASKLDFJGAG.
I HATE THIS PLACE SO SO SO MUCH.
'I've had such Zen lately,' Alex said. Maybe then, but lately? I've just been too exhausted and burned out from putting up with all this shit to get angry. Days like today? I could pour kerosene over everything and laugh as it all just burned to ash.rant it's a cool day at 96f/35c root has problems and fan the flames as your blazes burn root should see a shrink desert kerosene asshole boss when you fall i'll take my turn15 -
Well, here's the OS rant I promised. Also apologies for no blog posts the past few weeks, working on one but I want to have all the information correct and time isn't my best friend right now :/
Anyways, let's talk about operating systems. They serve a purpose which is the goal which the user has.
So, as everyone says (or, loads of people), every system is good for a purpose and you can't call the mainstream systems shit because they all have their use.
Last part is true (that they all have their use) but defining a good system is up to an individual. So, a system which I'd be able to call good, had at least the following 'features':
- it gives the user freedom. If someone just wants to use it for emailing and webbrowsing, fair enough. If someone wants to produce music on it, fair enough. If someone wants to rebuild the entire system to suit their needs, fair enough. If someone wants to check the source code to see what's actually running on their hardware, fair enough. It should be up to the user to decide what they want to/can do and not up to the maker of that system.
- it tries it's best to keep the security/privacy of its users protected. Meaning, by default, no calling home, no integrating users within mass surveillance programs and no unnecessary data collection.
- Open. Especially in an age of mass surveillance, it's very important that one has the option to check the underlying code for vulnerabilities/backdoors. Can everyone do that, nope. But that doesn't mean that the option shouldn't be there because it's also about transparency so you don't HAVE to trust a software vendor on their blue eyes.
- stability. A system should be stable enough for home users to use. For people who like to tweak around? Also, but tweaking *can* lead to instability and crashes, that's not the systems' responsibility.
Especially the security and privacy AND open parts are why I wouldn't ever voluntarily (if my job would depend on it, sure, I kinda need money to stay alive so I'll take that) use windows or macos. Sure, apple seems to care about user privacy way more than other vendors but as long as nobody can verify that through source code, no offense, I won't believe a thing they say about that because no one can technically verify it anyways.
Some people have told me that Linux is hard to use for new/(highly) a-technical people but looking at my own family and friends who adapted fast as hell and don't want to go back to windows now (and mac, for that matter), I highly doubt that. Sure, they'll have to learn something new. But that was also the case when they started to use any other system for the first time. Possibly try a different distro if one doesn't fit?
Problems - sometimes hard to solve on Linux, no doubt about that. But, at least its open. Meaning that someone can dive in as deep as possible/necessary to solve the problem. That's something which is very difficult with closed systems.
The best example in this case for me (don't remember how I did it by the way) was when I mounted a network drive at boot on windows and Linux (two systems using the same webDav drive). I changed the authentication and both systems weren't in for booting anymore. Hours of searching how to unfuck this on windows - I ended up reinstalling it because I just couldn't find a solution.
On linux, i found some article quite quickly telling to remove the entry for the webdav thingy from fstab. Booted into a root recovery shell, chrooted to the harddrive, removed the entry in fstab and rebooted. BAM. Everything worked again.
So yeah, that's my view on this, I guess ;P30 -
Take a break folks,
From work,
From code,
From tension,
From bugs,
Take a car, drive to the country side, breathe the fresh air, ride horses,
Have a meal, stay for a day or two, without internet, and then Be back to work.
This is what we all need now :D12 -
My team handles infrastructure deployment and automation in the cloud for our company, so we don't exactly develop applications ourselves, but we're responsible for building deployment pipelines, provisioning cloud resources, automating their deployments, etc.
I've ranted about this before, but it fits the weekly rant so I'll do it again.
Someone deployed an autoscaling application into our production AWS account, but they set the maximum instance count to 300. The account limit was less than that. So, of course, their application gets stuck and starts scaling out infinitely. Two hundred new servers spun up in an hour before hitting the limit and then throwing errors all over the place. They send me a ticket and I login to AWS to investigate. Not only have they broken their own application, but they've also made it impossible to deploy anything else into prod. Every other autoscaling group is now unable to scale out at all. We had to submit an emergency limit increase request to AWS, spent thousands of dollars on those stupidly-large instances, and yelled at the dev team responsible. Two weeks later, THEY INCREASED THE MAX COUNT TO 500 AND IT HAPPENED AGAIN!
And the whole thing happened because a database filled up the hard drive, so it would spin up a new server, whose hard drive would be full already and thus spin up a new server, and so on into infinity.
Thats probably the only WTF moment that resulted in me actually saying "WTF?!" out loud to the person responsible, but I've had others. One dev team had their code logging to a location they couldn't access, so we got daily requests for two weeks to download and email log files to them. Another dev team refused to believe their server was crashing due to their bad code even after we showed them the logs that demonstrated their application had a massive memory leak. Another team arbitrarily decided that they were going to deploy their code at 4 AM on a Saturday and they wanted a member of my team to be available in case something went wrong. We aren't 24/7 support. We aren't even weekend support. Or any support, technically. Another team told us we had one day to do three weeks' worth of work to deploy their application because they had set a hard deadline and then didn't tell us about it until the day before. We gave them a flat "No" for that request.
I could probably keep going, but you get the gist of it.4 -
Dev: “Ughh..look at this –bleep- code! When I execute the service call, it returns null, but the service received a database error.”
Me: “Yea, that service was written during a time when the mentality was ‘Why return a service error if the client can’t do anything about it?’”
Dev: “I would say that’s a misunderstanding of that philosophy.”
Me: “I would say it’s a perfectly executed example of a deeply flawed philosophy.”
Dev: “No, the service should just return something that tells the client the operation failed.”
Me: “They did. It was supposed to return a valid result, and the developer indicated a null response means the operation failed. How you deal with the null response is up to you.”
Dev: “That is stupid. How am I supposed to know a null response means the operation failed?”
Me: “OK, how did you know the operation failed?”
Dev: “I had to look at the service error logs.”
Me: “Bingo.”
Dev: “This whole service is just a –bleep-ing mess. There are so many things that can go wrong and the only thing the service returns is null when the service raises an exception.”
Me: “OK, what should the service return?”
Dev: ”I don’t know. Error 500 would be nice.”
Me: “Would you know what to do with error 500?”
Dev: ”Yea, I would look at the error log”
Me: “Just like you did when the service returned null?”
<couple of seconds of silence>
Dev: “I don’t know, it’s a –bleep-ing mess.”
Me: “You’re in the code, change it.”
Dev: “Ooohhh no, not me. The whole thing will have to be re-written. It should have been done correctly the first time. If we had time to do code reviews, I would have caught this –bleep- before the service was deployed.”
Me: “Um, you did.”
<a shocked look from Dev>
Dev: “What…no, I’ve never seen this code.”
Me: “I sat next to Chuck when you were telling him he needed to change the service to return null if an exception was raised. I remember you telling him specifically to pop-up an error dialog ‘Service request failed’ to the user when the service returned null.”
Dev: “I don’t remember any of that.”
Me: “Well, Chuck did. He even put it in the check-in comments. See…”
<check in comments stated Dev’s code review and dictated the service return null on exceptions>
Dev: “Hmm…I guess I did. –bleep- are you a –bleep-ing elephant? You –bleep-ing remember everything.”
<what I wanted to say>
No, I don’t remember everything, but I remember all the drive-by <bleep>-ed up coding philosophies you tried to push to the interns and we’re now having all kinds of problems I spend waaaaay too much time fixing.
<what I said, and lied a little bit>
Me: “No, I was helping Nancy last week troubleshoot the client application last week with the pop-up error. Since the service returned a null, she didn’t know where to begin to look for the actual error.”
Dev: “Oh.”1 -
4+ years ago, in an interview, I was asked if I was familiar with keeping backups of my code on Google Drive.
When I asked them to explain what that is, they said that after a deployment, they make a ZIP file of the project and keep it on Google Drive.
When I asked about using GitHub/BitBucket they said they don't know what that is and neither do they intend on using it.
So yeah .....12 -
Me and a junior coder are working on a project. However, he likes to think he's funny and say "Ok google" to stop me from using my phone.
He said "Ok google, search midget porn" when I was calling my mom so naturally I need to get back at him, so when he's in the rec room, I backed up all his code on my flash drive, and copied it to the clipboard, and removed all project files from his computer.
He came back while I was in the bathroom, and when I reentered the room and was balling his eyes out, that his project was gone. I said to him, don't ok google me again and I handed him the flash drive back. He has never done anything bad again.12 -
When I was in sixth form, I taught my friend how to create empty files using Python. He soon learnt that you could get around the quota enforcer this way.
He was curious to see what would happen if you filled the entire drive to maximum so he ran the code for an ~8TB file. Before he could delete it, he was told to log off. Nobody could save their work and backups weren't performed for 24 hours.
It's safe to say they weren't impressed when they found this.9 -
rant
The Java course at our Uni requires us to do an end semester project - A Java App with Swing for GUI and some Multithreading code in it.
They asked us to upload the code to drive. I was bored and was checking out my friends' projects.
The code below is what I saw in one of the projects. They have simply called a thread with an empty run method because the project required to use multithreading concepts, wtf.
But then, It is no surprise to me cause these are the people who memorize code and vomit code for marks.
I am worried that people are going to be awarded degrees and called software engineers.
God save the software industry!24 -
It's a Sunday, playing around with code/servers/config stuffs and decided to give Arch another try! Downloaded Apricity OS (Yes, I still love beautiful interfaces I don't have to fully configure), realized I didn't have any spare discs so went looking for a USB flash drive.
Seriously. Those FUCKERS are always around when you don't need them.
But ohhhhh, the FUCKING SECOND YOU NEED THEM, THEY ARE NO-FUCKING-WHERE TO BE MOTHERFUCKING FOUND.
Well, there goes my FUCKING plans for today.14 -
TLDR;
Wrote a slick scheduling and communication system allowing me to assign photography resources based on time and location.
I'll tell you a little secret ... I'm not actually a dev. I'm a photographer, pretending to be a dev.
Or ... perhaps it's the other way around? (I spend most of my time writing code these days, but only for me - I write the software I use to run my business).
I own a photography studio - we specialize in youth volleyball photography (mostly 12-18 year old girls with a bit of high school, college and semi-pro thrown in for good measure - it's a hugely popular sport) and travel all over the US (and sometimes Europe) photographing.
As a point of scale, this year we photographed a tournament in Denver that featured 100 volleyball courts (in one room!), playing at the same time.
I'm based in California and fly a crew of part-time staff around to these events, but my father and I drive our booth equipment wherever it needs to go. We usually setup a 30'x90' booth with local servers, download/processing/cashier computers and 45 laptops for viewing/ordering photographs. Not to mention 16' drape and banners, tons of samples, 55' TVs, etc. It's quite the production.
We photograph by paid signup only - when there are upwards of 800 teams/9,600 athletes per weekend playing, and you only have four trained photographers, you've got to manage your resources!
This of course means you have to have a system for taking sign those sign ups, assigning teams to photographers and doing so in the most efficient manner possible based on who is available when the team is playing. (You can waste an awful lot of time walking from one court to another in a large convention center - especially if you have to navigate through large crowds - not to mention exhausting yourself).
So this year I finally added a feature I've wanted for quite some time - an interactive court map. I can take an image of the court layout from the tournament and create an HTML version in our software. As I mouse over requests in one window, the corresponding court is highlighted on the map in another browser window. Each photographer has a color associated with them. When I assign requests to a photographer, the court is color coded with the color of the photographer. This allows me to group assignments to minimize photographer walk time and keep them in a specific area. It's also very easy to look at the map and see unassigned requests and look to see what photographer is nearby.
This year I also integrated with Twilio and setup a simple set of text shortcuts that photographers can use to let our booth staff know where they are, if they have memory cards that need picking up, if they need water/coffee/snack, etc. They can also move assignments on their schedule or send and SOS for help if it looks like they aren't going to be able to photograph a team.
Kind of a CLI via the phone. :)
The additions have turned out to be really useful and has made scheduling and managing the photographers much easier that it was in the past.18 -
My son loves...loves Star Wars, so when Star Wars Battlefront (on the PC) went on sale, he jumped on it.
To my shock (I'm not a big gamer), the game is filled with hackers/cheaters that are able to give themselves 'god' mode, so they can kill in one shot and take no damage.
My son (and others in the game) keeps 'reporting' them, but it looks like an issue EA is ignoring.
My son keeps asking me "You're a programmer, can't you fix the game so they can't do that?"
Good lord...I could care less about russians "hacking" our election (moronic press, doesn't even know what that means), but hacking my son's favorite game!...hmm..wonder how long it would take me to drive to EA headquarters and find that SOB dev manager in charge?
I get it, cheaters are gonna cheat, but fix your friggin' code! Aren't you embarrassed!?
Don't give me any of that "we don't know how they are doing it..." nonsense. This is devrant, not <insert media outlet you hate>.13 -
!code
I literally cannot get this computer to boot from ANYTHING other than its hard drive.
I want to boot from a usb flash drive, but the bios doesn't support that. it supports standard and 120mb floppies, ZIP drives, usb floppies, usb cd drives, etc. but not a generic USB drive. You'd think the bios developers would have heard of them back in 2012, but they also refer to Windows as "window os", so who knows.
I changed the boot order multiple times to include everything that might possibly include a usb flash drive, and then just tried all of the other options as well. No luck. Everything just booted straight to Windows.
Okay, that's not exactly unexpected, so I found a boot manager that allows booting to usb drives, and burned that to a cd. I made sure the boot order included "CDDRIVE" first (and "USB-CD" second just to be sure), and tried again. The bios refused to boot from the cd because it's in a cd/dvd drive, and cd drives are VASTLY different beasts than dvd drives, apparently. Like, it didn't even ask the drive to spin up! It just booted straight into Windows.
After a few more reboots (and quite a few middle fingers), my dvd drive magically appeared in the list of allowed boot devices. Why did it just show up now? No clue :/ I'm just happy it's there.
So, I pick that, save and exit, and wait for my shiny new boot manager to pop up. The cursor flashes a bit, moves around, and flashes some more. Then Windows starts loading.
what the crap? why?
So this time I disable booting from the hard drive altogether. In fact, I disable everything except the dvd drive, because screw this, and save/restart for the twelfth time.
Windows greets me.
Again.
What the hell?
At this point I'm tempted to unplug the friggin' drive. If Windows still greets me after that, I'm just going to check myself into an asylum and call it a life.
But seriously.
Either the boot manager in question is triple-faulting and the bios is transparently failing-over to the previous boot config (Windows), or said boot manager is just like "yolo!" and picks Windows anyway.
If a different boot manager doesn't work, I'm totally out of ideas.
Edit: disabling HD boot entirely and removing the boot manager cd also results in Windows loading. It's like the bios is completely ignoring my settings. :/16 -
After returning back from the company we were purchasing a new phone system (hardware+software, $100K+, kind of a big deal)
VP: “I need the new phone system software integration for our CRM by next week. I need to demo the system for the other VPs”
Me: “No problem. Were you able to get their API like I asked?”
VP: “Salesman didn’t know for sure what that was, but he said all the developer software documentation is on their site.”
Me: “Did he give you a URL? Their main site is all marketing mumbo-jumbo. I assume there is another one specific for developers.”
VP: “Yea, he might have said something, but I don’t understand why you need it. The salesman said the integration would be seamless. He showed me several demos.”
Me: “No, I mean I need to know, is the API a full client install? a simple dll? is this going to be a web service integration? How will I know what to program against?”
VP: “I think I heard him say something about COM? Does that sound like an API?”
Me: “It’s a start. Did he provide you anything, a disk, a flash drive, anything with the software?”
VP: “No, only thing he told me was our CRM integration would be seamless and our development team would have no problems.”
Me: “OK..OK…I get it…he’s a salesman. Is there an 1-800 number I can call? A technical support email address? Anyone technical I can reach out to?”
VP: “Probably, but I don’t understand what the problem is. I need the CRM integrated by next week. I gave the other VPs a promise we would get it done. I do not break promises.”
Me: “Wait…when are we installing the new system?”
VP: “Well, the purchase order will be cut at the end of the month’s billing cycle, the company has about a two month turnaround time to deliver and install the hardware, so maybe 3 months from now? Are you going to be able to have the integration ready for next week?”
Me: “If we won’t see any of the hardware for 3 months, what exactly am I integrating with?”
VP: “That API you wanted or whatever it is. COM…yea, it’s COM. I was told the integration would be seamless and our developers would have no problem. I don’t understand why you can’t simply write the code to make it work. Getting the hardware installed is going to be the hardest part.”
Me: “OK, so I have no documentation, we have no hardware, no software, and no idea what this ‘seamless integration’ means. I’m afraid there isn’t anything I can do right now. ”
VP: “Fine!...I’ll just have to tell the other VPs you were not able to execute the seamless integration with the CRM.”
Which he did. When the hardware+software was finally installed, they hired consultants (because I “failed”). I think the bill was in the $50K range to perform the ‘integration’ which consisted of Excel spreadsheets (no kidding). When approached with the primary CRM integration, the team needed our API documentation, a year’s development time and $300K. I was pissed off enough, and I had the API documentation, I was able to get the basic CRM integration within 3 days. When an agent receives a call, I look up the # in our database, auto-fill the form with the customer info, etc. Easy stuff when you have the documentation.
The basics worked and the VP was congratulated by ‘saving’ the company $300K. May or may not have been bonuses involved, rumors still out on that one, but I didn't see em'. Later my manager told me the VP was really ticked that I performed the integration ‘behind his back’, but because it was a success, he couldn’t fire me.10 -
When I discovered Clean Code, design patterns, TDD and BDD. It just clicked. Ever since everything build so easy and obviously. I no longer have most of the code problems folks rant here about.
That's when it came to me: it's not enough to know how to write code. To climb off those amateur shoes I must adopt those methodologies, so that the code would be decoupled from me, from my style, and I've got to let tests drive my code rather than vice versa to have a flexible and reliable codebase that is cheap and easy to maintain/extend.40 -
Once went for an interview for a senior web developer role. The first interview was a coding test ( not a problem, been coding for years and know I can do it). The company boasted that it supported pair programming.
I was sat at in an open plan office In front of a machine and given a question sheet of 10 code questions/puzzles and asked to solve them. Then out of nowhere 5 other senior devs appeared and stood behind me and proceeded to comment /question every single line I typed (so no pressure then).
I did questions 1-5 (fairly easy tbh) but all the devs behind me critiquing every single line started to drive me crazy so I asked if it was normal for them to interview this way and was told 'yes' and that after a year of trying to find someone they had been unsuccessful.
I told them that I wanted to leave the interview at that point; I don't mind my code being critiqued just prefer it when I've at least finished the line. Forcing you into a pair programming scenario in the interview really didn't feel right.
To this day (2years later) I still see ads for that very same job3 -
As a human being, you're multithreaded. You can type with multiple fingers, you can drive and hold a conversation at the same time. The only blocking function we have to deal with is sneezing, where all current activity must be suspended for the duration of the sneeze. That's pretty annoying, especially when you're driving and trying to hold a conversation. You don't want to write code that's sneezy.7
-
"Are you familiar with uploading your code to Google Drive?"
I left the building at that exact moment.7 -
So rewind back about 24 years. I was a little kid who thought computers were the coolest thing evar, and our family had just gotten our first machine (a monstrous tower from a company named CyberMax, running Win 3.11 on DOS 6, 33MHz and a 250MB hard drive).
My aunt (big into coding at the time) came by with a box full of disks and loaded the machine up with all kinds of games and fun stuff. One of the thing she installed was Hoyle Classic Card Games (https://playclassic.games/games/...)
My parents fell in love with this and played it for hours. The problem was, the process to get it started, while not complicated, was still a pain in the ass. You had to either hammer F6 to get the startup menu and type a bunch of commands to switch to the directory and start the game, or let it boot into windows, then leave windows for DOS and do the same thing.
On a lark, when we had gotten the machine, mom had also bought this little dos programming handbook. I can't find it nowadays, but it went into very exhaustive detail on the cool things you could do with batch files. I was a voracious reader, especially on anything to do with computers, and one of the things the book covered was how to write startup menus using the CHOICE command! Little me figured out that you could write this into the AUTOEXEC.bat, and have a menu come up on every start!
It took me a couple days of piddling around (again, I was like 6 or 7, and this was the first "program" I'd ever written), but I eventually got it to the point where you'd turn the computer on, and the first thing it would do is ask if you wanted to go into windows, or if you wanted to play cards. I was proud as hell when this was set up and working!
I didn't do much writing of programs since then (I was more interested in games at the time), but yeaaaarrrs later, I encountered Why's Poignant Guide to Ruby, fell in love, and I've been hacking code ever since2 -
YES FINALLY SOMEBODY REPLIED TO MY JOB OFFER ON UPWORK LET ME OPEN THE MESSAGE
A LINK TO A ZIP FILE WITH PASSWORD THAT LOOKS SO SKETCHY HMMMMMMMMMMM
LETS OPEN IT
WHATS THIS
- aboutus/
-- COMPANY PROFILE.docx
-- Paiza.docx
-- PROJECT WORK.docx
- requirement.lnk
- training/
-- discussion/
--- instruction/
---- democrat/
----- marketing.bat
A MARKETING.BAT FILE FOR A JOB OFFER??? HMMM THATS SO INTERESTING LET ME OPEN THIS MARKETING.BAT IN VSCODE
OH WOULD YOU LOOK AT THAT 10,000 LINES OF CODE OF ENCRYPTED CIPHER ENCODED MALWARE TROJAN MESSAGE TO FUCK UP MY C DRIVE.
WHY EVEN BOTHER. WHY DO YOU FUCKING WASTE MY FUCKING TIME YOU *********FUCKING*******++++ SCAMMERS I HOPE YOU GET CANCER AND YOUR WHOLE FAMILY DIES IN THE MOST HARMFUL PAINFUL SLOW DEATH I HOPE SOMEONE POURS ACID ON YOUR FUCKING FACE AND YOU END UP AT A MEXICAN CARTEL GORE VIDEO WEBSITE WHERE THEY CHOP YOUR FUCKING ARMS AND LEGS OFF AND PUT A PITBULL TO MAUL YOUR FUCKING TINY DICK OFF AS YOUR HEAD WATCHES IN AGONY AND YOUR ARMLESS AND LEGLESS BODY FEELS ALL PAIN WHILE YOU'RE DRUGGED WITH ADRENALINE TO STAY ALIVE AS MUCH AS POSSIBLE AND RIGHT WHEN YOU'RE ABOUT TO FUCKING DIE THEY CUT YOUR FUCKING HEAD OFFFF DECAPITATED LIKE A FUCKING USELESS TURD SHIT FAGGOT WASTE OF OXYGEN SCAMMING CANCER FUCK
WHY SCAM ENGINEERS ON UPWORK????? WHAT DO YOU GET FROM IT????11 -
My worst interview ever was my first interview fresh out of college. After the initial phone screen, they asked me to drive 2 hours to their office to give me a "code challenge."
The challenge was to spend 4 hours writing a simple rest API for a blog type thing, but the catch was to not use any existing libraries for data access and instead write an entirely database agnostic DAL. Then after I finished they sat me in a conference room with 3 of their engineers and the CEO to just tear apart my code.
For a JUNIOR position to someone fresh out of college.
I guess I defended it well, because they asked to continue the process l, but after that I found a different position.4 -
"Colleague" (he's there for day-time spending, he doesn't actually have a job) of mine keeps telling me I should F off with pushing for Docker, Git and CakePHP because they add an additional amount of learning for interns that they might not need to learn for school.
He wants us to keep working with the following:
- Google Drive for codebase sharing
- FileZilla (or atleast an FTP) for deployment
- "from scatch" PHP code where business logic and front-end code are all slapped into one big file and where functions are also slapped into one big file. also, opening and closing the database connection for each query made
Guy basically wants us to deliver a crappy products that we might not be able to maintain and are prone to a wide-variety of issues.
Yes, let's limit our company to *only* the things that interns need to learn for school, what could *possibly* go wrong :^)11 -
Somewhere in a lonely break room
There's a guy starting to realize that eternal hell has been unleashed unto him.
It's two a.m.
It's two a.m.
The boss has gone
I'm sitting here waitin'
This desktop's slow
I am getting tired of fixin' all my coworkers' problems
Yeah there's a bug on the loose
Errors in the code
This is unreadable
Rubber ducky can't help
I cannot debug, my whole life spins into a frenzy
Help I'm slippin' into the programming zone
Git push to the prod
Set up a repo
My hard drive just crashed
All my code is gone
Where am I to go
Now that I've broke my distro
Soon you will come to know
When you need Stack Overflow
Soon you will come to know
When you need Stack Overflow
I'm falling down a spiral
Solution unkown
Disgusting legacy, ugly code
Can't get no connection
Can't get through to commit
Well the night weights heavy
On my confused mind
Where's the error on this line
When the CEO comes
He knows damn well
To keep his distance
And he says
Help I'm slippin' into the programming zone
Git push to the prod
Set up a repo
My hard drive just crashed
All my code is gone
Where am I to go
Now that I've broke my distro
Soon you will come to know
When you need Stack Overflow
Soon you will come to know
When you need Stack Overflow
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow4 -
A typo today has rendered me the joke of the office... 😂
Almond's PR: "Added missing unit testes to classes Foo and Bar"
----
Bob: "LGTM. Bet that took some balls."
Craig: "LGTM. Missing unit testes drive me nuts."
Ian: "LGTM. Write your testes with your code guys, a bit bollocks to have to add them afterwards." -
At my first job I had a senior who took backups of code by zipping it and uploading on Google drive. Once I told him why don't you use git, he said it's not as secured as Google.
I left the job one month later2 -
!Rant
Story, only read this if you feel like wasting your time
Ok so I live in a small village and it takes around 15 minutes to get to the next city by car. I can't drive yet because I am 15 and so I would need my parents to drive me there. There are also no buses anymore which drive to the city after 2pm.
Most of my friends live in that city, none of them code. We always meet on a discord server and then play games or do some other shit. Today I got online at around 3pm and when I joined the discord server they asked me if I wanted to go see the movie 'IT' with them tonight, I said yeah of course (I am a huge fan of horror movies), but only if my parents come home early enough to drive me there.
Time passed and then my last friend left the discord server because he had to walk to the cinema.
I was the last one still on the server and also the one with the farest way to the cinema. I already knew that my parents wouldn't come home in time anymore and so I decided to just start coding something. I usually code while listening to some music and so I switched over to spotify to choose a playlist. I just randomly clicked on the first playlist spotify recommended me and the song started playing: 'Sound of silence'.
Fuck you spotify algorithm.
I know that not being able to go to the cinema with your friends is a fucking stupid reason to be sad but I just feel very sad right now. Sitting alone in my dark room staring at my computer screen.
Sorry for wasting your time18 -
It feels SO good to have nothing to lose on your system! Code on GitHub, pictures on an external disk, documents on Google Drive and OneDrive and bookmarks etc. on my Google Account. If my PC were to crash completely then I wouldn't be as lost as I'd normally be :D3
-
One of our senior dev enjoys berating the other devs because they don't check-in code according to his schedule (once a day, once an hour..he flip-flops a lot), then when they do, he 'reviews' their code, beating them up because of incomplete features, commented out code..petty..petty nonsense.
Ex. (this occurred couple of weeks ago).
Ralph: "The button click code in this event isn't complete"
Dev: "No, its not, the code in my development branch. You said it was best practice to check in code daily whether the code worked or not. I didn't finish the event last night and ..."
Ralph: "Exactly. Before you check any code into source control, it has to work and be 100% complete. What if someone moved that code into production? What happens if that code got deployed? I'm not even going talk about the lack of unit tests."
Dev: "Uh..well..the code is on the development channel, and I branched the project in my folder ...I didn't think it mattered.."
Ralph: "Ha ha...you see what happens when you don't think...listen..."
- blah blah blah for 10 minutes of hyperbole nonsense of source control check-in 'best practice'
This morning Ralph's computer's hard-drive crashed.
Ralph: "F-k! ..F-k! ... my f-king computer hard drive crashed!"
Me: "Ouch...did you loose anything important?"
Ralph: "A f-king week of code changes."
Me: "You checked everything into source control on Friday ...didn't you?"
Ralph: "F-k no!...I got busy...and...f-k!"
Me: "Look at the bright side, you'll have a good story to tell about the importance of daily check-ins"
Oh...if looks could kill. Karma...you're the best. -
The one that made me quit was when I was told I had to drive to the data centre and do a backup every day over the bank holiday weekend with no extra pay or time off. For no reason. And yes I know I'm an idiot for doing it but whatever.
The one that made me walk out, a month and a half later, was when I came in on Monday morning to discover that my boss had entirely rewritten the code I had spent literal months on in one weekend. Naturally he'd broken it and said it was an improvement.2 -
All the noob jokes about "tee hee I write such bad code exdee" fucking drive me nuts.
There are absolutely such things as good codebases, in any language. By posting "tee hee funny relatable" "memes" about your shitass code you just make yourself look like a fucking idiot who excuses poor quality with "haha so relatable!" bullshit excuses.
Thank you for being the literal cancer of the industry, oversaturating the markets and making all of our managers think we're fucking idiot babies that have to be wrangled like cats in order to get a single feature out the door, devoid of rational thought or a modicum of expertise.
Fuck you. You're the problem. Be better or find another profession where slacking off is acceptable.18 -
Can code awesomeness for my clients.
Can drive traffic to almost any website.
Can turn half-baked ideas into money for clients.
Have absolutely no game at all with the opposite sex.
Sometimes the tradeoff of being a geek sucks.6 -
Many of you who have a Windows computer may be familiar with robocopy, xcopy, or move.
These functions? Programs? Whatever they may be, were interesting to me because they were the first things that got me really into batch scripting in the first place.
What was really interesting to me was how I could run multiples of these scripts at a time.
<storytime>
It was warm Spring day in the year of 2007, and my Science teacher at the time needed a way to get files from the school computer to the hard-drive faster. The amount of time that the computer was suggesting was 2 hours. Far too long for her. I told her I’d build her something that could work faster than that. And so started the program would take up more of my time than the AI I had created back in 2009.
</storytime>
This program would scan the entirety of the computer's file system, and create an xcopy batch file for each of these directories. After parsing these files, it would then run all the batch files at once. Multithreading as it were? Looking back on it, the throughput probably wasn't any better than the default copying program windows already had, but the amount of time that it took was less. Instead of 2 hours to finish the task it took 45 minutes. My thought for justifying this program was that; instead of giving one man to do paperwork split the paperwork among many men. So, while a large file is being copied, many smaller files could be copied during that time.
After that day I really couldn't keep my hands off this program. As my knowledge of programming increased, so did my likelihood of editing a piece of the code in this program.
The surmountable amount of updates that this program has gone through is amazing. At version 6.25 it now sits as a standalone batch file. It used to consist of 6 files and however many xcopy batch files that it created for the file migration, now it's just 1 file and dirt simple to run, (well front-end, anyways, the back-end is a masterpiece of weirdness, honestly) it automates adding all the necessary directories and files. Oh, and the name is Latin for Imitate, figured it's a reasonable name for a copying program.
I was 14, so my creativity lacked in the naming department >_<1 -
So, the uni hires a new CS lecturer. He is teaching 230, the second CS class in the CS major. Two weeks into the semester, he walks in and proceeds to do his usual fumbling around on the computer (with the projector on).
Then, he goes to his Google Drive, which is empty mostly, and tells us that he accidentally wrote a program that erased his entire hard drive and his internet storage drives (Google, box, etc.)...
I mean, way to build credibility, guy... Then he tells us that he has a backup of everything 500 miles away, where he moved from. He also says that he only knows C (we only had formally learned Java so far), but hasn't actually coded (correction: typed!) in 20+ years, because he had someone do that for him and he has been learning Java over the past two weeks.
The rest of the semester followed as expected: he never had any lecture material and would ramble for an hour. Every class, he would pull up a new .java file and type code that rarely ran and he had no debugging skills. We would spend 15 minutes trying to help him with syntax issues—namely (), ;— to get his program running and then there would be a logic issue, in data structures.
He knew nothing of our sequence and what we knew up until this point and would lecture about how we will be terrible programmers because we did not do something the way he wanted—though he failed to give us expectations or spend the five minutes to teach us basic things (run-time complexity, binary, pseudocode etc). His assignments were not related to the material and if they were, they were a couple of weeks off. Also, he never knew which class we were and would ask if we were 230 or 330 at the end of a lecture...
I learned relatively nothing from him (though I ended up with a B+) but thankful to be taking advanced data structures from someone who knows their stuff. He was awful. It was strange. Also, why did the uni not tell him what he needed to be teaching?
End rant.undefined worst teacher worst professor awful communication awful code worst cs teacher disorganization1 -
+ “I’m drunk, but I can still drive.”
+ “I’m tired, but I can still finish this piece of code.”
+ " I don’t need a silly seatbelt.”
+ “Tests? Naw, I’ll just push this to the Master branch.”2 -
Our teacher just told us to share our code via drive or dropbox or something like that, and I was there like "hey ever heard of git?????"8
-
I was in second year of University when I joined the internship, I knew the business idea sucks and he wouldn't be able to carry out the operations either. Little did I know that I will work with the dumbest team ever, literally, the dumbest.
So, the major chunk of the software was outsourced to a consultancy. I was a tech intern, and we were developing an Android App that will save your parking location, let you reserve locations and all etc.
I knew I have stepped on a wrong turf, but again, I had nothing better to do that summer. So, for a very meager stipend, I said yes to a very stupid project. Let the stupidity flow...
~ The boss, had quit his job for this dumb idea with no funding, no team, nothing.
~ He was pursuing a certification course in Android Development from somewhere, where their final project will be a calculator!
~ He had little to no tech skills, hardly knew Java but was leading an Android App Dev project in Java. He had little to no managerial, marketing or sales skills either.
~ For a brief period, I had to work along with the consultancy guys to ramp up their work. They would take backups in a USB drive every evening, and share each others code using the same. VCS died a painful death that day.
~ They hardly wrote functions, rather, wrote very long code in the main (onCreate) function. Code style died of cancer.
~ They couldn't compress an image before sending it to a server. I had to do it for them.
~ Had no concept of creating utility classes.
And best of all,
~ Wrote 20 cases (switch case) with the same code! Instead of using a loop...1 -
Fucking Apple... my MacBook Pro committed suicide upgrading from High Sierra to Mojave, had to wipe the drive. After much trouble resetting my Apple ID (put the password AND the two-factor code in the password field.. who the fuck thought that up), it tells me Mojave isn't compatible with this computer.
... fine, it's a 2012 machine I can respect that, but you blew away my system to upgrade THIS WAS YOUR IDEA NOT MINE...
...and so I just try to update to El Capitan or something because I'm on FUCKING OSX LION now (swirling galaxy, so sparkle, such stars)
...and the App Store won't let me. Why?
"Software Update Required"
"To make changes to your payment information, you need to upgrade your Mac to the latest version of macOS."
just.
wow. -
I've got a HDD, gotta look for any data left on it. I don't need a 1:1 copy of the drive to determine if any data is even there still, and i'm also strapped for space, so I threw together a little 20-line or so Python script to skip over large amounts of empty space so I only have to sift through what little it finds to see if anything's left at all. I wrote it, ran it... and it took a while. Too long. My SSD was floored and RAM was full for no reason. I double-checked my code...
device.seek(0)
device_size = len(device.read())
If you don't get it, this would've tried to load the ENTIRE DRIVE'S CONTENTS into RAM before giving the length. The drive's 128GB or so. That's not happening.
I'm a fucking idiot.
EDIT:
This is what this was for. This ain't ext4. What in the fuck...?11 -
One of those days when i feel like complete shit and wish i hadn’t woken up.
I heard back from an interview i did last week (one of the faang type) and the recruiter started with “You didn’t impress any of your interviewers”. Man that hurt. I can’t unhear that. He went ahead to say they all recommended a mid-level role for me (they apparently said i had potential and could easily grow into a senior eng) instead of the senior lead i applied for. This is also subject to getting approval to hire mid-level engineers because the team needs more people but they only got approval to hire senior engineers. This cunt also added “dont worry about it. Just go about your usual business and i’ll call you next week if we have gotten the approval”. Ass! All i can do is worry because that is what i do best.
I think i am more sad and disappointed in myself because i thought the interviews went well. Wrote decent code and came up with good solutions on time. Had a good conversation with interviewers. Apparently for a senior, you cannot make mistakes which i did but once the interviewer gave me a clue, i got back on track.
Anyway, i slept with this anxiety, then woke up with tummy ache. On the drive out this morning to go to the bank, i drove my car into a pole and broke off my side mirror. Then my fucking power generator stopped working. And on my way to go and get my fixed mirror from the mechanic, my exhaust pipe broke in half due to a possible pothole i drove into.
Those fucking days where all that could go wrong goes wrong. My head is fucking pounding i can barely move my head without wincing. I am running out of money fast (i support my entire family) and i am worried about not getting a job. This blow to my confidence makes me feel worthless like i am not good for anything. Recruiter suggested i do another senior engineer interview for a different team which i passed the test for but i know the outcome would most likely be the same and i wanted the first team really bad. I just want to lie in bed and cry all day but this fucking headache won’t let me. -
"I don't have any issues with that (OS, code push, software, etc), so I'm not sure why you are having issues." I love reading comments like that, as if that solves the issue. The fuck does it matter if you don't have issues, they are having issues you moron. For a place for developers you'd think they'd be able to think logically, maybe they're in the wrong line of business. Maybe that software had an error parsing some file because some bit got flipped when writing to the HDD because there's an issue with the drive and the ECC failed for some reason, who cares. There's an issue and you saying it works for you makes you sound like a fucking moron... There's an error/crash, it happens, that's software.4
-
If you can be locked out of it remotely, you don't own it.
On May 3rd, 2019, the Microsoft-resembling extension signature system of Mozilla malfunctioned, which locked out all Firefox users out of their browsing extensions for that day, without an override option. Obviously, it is claimed to be "for our own protection". Pretext-o-meter over 9000!
BMW has locked heated seats, a physical interior feature of their vehicles, behind a subscription wall. This both means one has to routinely spend time and effort renewing it, and it can be terminated remotely. Even if BMW promises never to do it, it is a technical possibility. You are in effect a tenant in a car you paid for. Now imagine your BMW refused to drive unless you install a software update. You are one rage-quitting employee at BMW headquarters away from getting stuck on a side of a road. Then you're stuck in an expensive BMW while watching others in their decade-old VW Golf's driving past you. Or perhaps not, since other stuck BMWs would cause traffic jams.
Perhaps this horror scenario needs to happen once so people finally realize what it means if they can be locked out of their product whenever the vendor feels like it.
Some software becomes inaccessible and forces the user to update, even though they could work perfectly well. An example is the pre-installed Samsung QuickConnect app. It's a system app like the Wi-Fi (WLAN) and Bluetooth settings. There is a pop-up that reads "Update Quick connect", "A new version is available. Update now?"; when declining, the app closes. Updating requires having a Samsung account to access the Galaxy app store, and creating such requires providing personally identifiable details.
Imagine the Bluetooth and WiFi configuration locking out the user because an update is available, then ask for personal details. Ugh.
The WhatsApp messenger also routinely locks out users until they update. Perhaps messaging would cease to work due to API changes made by the service provider (Meta, inc.), however, that still does not excuse locking users out of their existing offline messages. Telegram does it the right way: it still lets the user access the messages.
"A retailer cannot decide that you were licensing your clothes and come knocking at your door to collect them. So, why is it that when a product is digital there is such a double standard? The money you spend on these products is no less real than the money you spend on clothes." – Android Authority ( https://androidauthority.com/digita... ).
A really bad scenario would be if your "smart" home refused to heat up in winter due to "a firmware update is available!" or "unable to verify your subscription". Then all you can do is hope that any "dumb" device like an oven heats up without asking itself whether it should or not. And if that is not available, one might have to fall back on a portable space heater, a hair dryer or a toaster. Sounds fun, huh? Not.
Cloud services (Google, Adobe Creative Cloud, etc.) can, by design, lock out the user, since they run on the computers of the service provider. However, remotely taking away things one paid for or has installed on ones own computer/smartphone violates a sacred consumer right.
This is yet another benefit of open-source software: someone with programming and compiling experience can free the code from locks.
I don't care for which "good purpose" these kill switches exist. The fact that something you paid for or installed locally on your device can be remotely disabled is dystopian and inexcuseable.12 -
School's windows installations had the UAC set to lowest.
Anyone could install malware or fiddle with important settings.
Oh by the way, the same school who's gData found it funny to go through my USB drive and delete all executables and all my code because it was "possibly malicious".
Started installing random crap and messing with people in retaliation.
Was fun.
Until I got caught.
Good thing I compiled a list of security flaws earlier on.
From that day on, everytime I messed up, I sold them two security vulnerabilites to let me off the hook.
These included access to all kinds of drives in the windows network, accessing other PCs desktop, literally uninstalling random printers from the network etc..
Fun time.3 -
What I say:
Ah shit man! Spring break! Finally gonna be able to continue working on my personal project. Study, catch up with some books and tv shows while continuing to code!
What my wife hears:
Oh cool! Now I have someone to drive all around town getting me useless shit that I don't need while I am at work!!!
-_____________________________- -
VSCodium, just for a little moment, please go fuck yourself.
I mostly use netbeans but for just a little I'm using VSCodium (VSCode without the Microsoft calling home bullshit).
Just had this error I didn't see that fast and then, usually, whenever you put your cursor on the tee underlined code, it tells you the error in this drive-by popup thingy.
The goddamn popup disappears so fucking quick that its impossible to read.
Ended up trying to capture a screenshot in time which worked at try number 10+, then saw the error and corrected it.
VSCodium go fuck yourself. I'm not ready for this shit when I've just woken up and haven't fully drank my first coffee yet (or this is more like a triple espresso as for strength)
😡7 -
"Let the developers consider a conceptual design,” the King said, for about the twentieth time that day._
“No, no!” said the Queen. “Tests first—design afterwards.”
“Stuff and nonsense!” said Alice loudly. “The idea of writing the tests first!”
“Hold your tongue!” said the Queen, turning purple. “How much code have you written recently, anyway?” she sneered.
“I won’t,” said the plucky little Alice. “Tests shouldn’t drive design, design should drive testing. Tests should verify that your code works as it was designed, and that it meets the customer’s requirements, too,” she added, surprised by her own insight. “And when you drive your tests from a conceptual design, you can test smarter instead of harder.”4 -
Development world is always changing and evolving... It changes before you know it...
So, having the ability to quickly adapt and learn is a must for any Developer... And, this is the one thing that I am sure that everyone knows about or heard about..
But, my advice is quite simple:
"Don't rush into participating in a race, just because everyone else is doing so.
The trick is not to move quickly.. But, to move one step at a time, at the pace in which you are at your most comfortable...
It might seem counterintuitive and a contradiction to what I have said earlier.. But, I hope that by the end of this rant, you will be able to understand my perspective..
This advice is especially useful for people still finding and searching for their place in our world..
Charles Darwin, very wisely understood the philosophy behind 'Survival of the Fittest'..
By 'fittest', he didn't refer to the ones considered to be the strongest or having the most intelligence, but the ones that had mastered the ability to adapt to changing circumstances..
Adaptability is important, but not at the cost of understanding and learning about the fundamental pillars on which this world stands..
Don't rush because when you run, your visions starts to become more narrow.. In your pursuit to reach your goal, you lose the ability to look at the macro details surrounding your goal..
Learning new technology is important, but that doesn't mean that you don't learn about various approaches or how to design a more logical or efficient solution...
Refactoring the code, developing good Testing procedures, learning to interact with your fellow developers are as crucial as learning about the changing trends...
Even, in this ever-changing world, understand that some things will always remain the same, like the adrenaline that course through your veins when you finally solve a long-standing problem...
Curiosity, Discovery and Exploration are the key pillars and hence, when we rush in, we might stop exploring and lose curiosity to discover new and exciting ways to reach our goal..
Or, we might also end up losing the drive that grips us and motivates to continue moving forward inspite of the challenges standing between us and our destination..
And, believe me, once you lose this quality, you might still succeed but the contentment and the satisfaction that you feel will be lost..
And, then, you will remain a developer only through your designation... And, that in my personal opinion, the worst punishment.3 -
Took me awhile, and 3 reinstalls but I finally got my second hard drive on Linux, Kubuntu with most of the things I use to code here and zsh on powerlevel9k. Yey!8
-
A group member in my senior level computer science class is afraid of the command line so they change code through the GitHub website, essentially using it like Google Drive.
-
Made an Android app a while ago. I needed some pet project so I decided to go with Java for Android. First time, no experience at all.
So everything went ok, I had a little help from a colleague, structuring code, and pushing to the store. Work done app was doing ok.
A year later I came back to this project. I needed to fix a bug - date time and daylight savings crap. 😥
Spent a week on it. Ready to push a new version to the store, with some extra features! Build apk. All good.
Wait. I need to sign the APK? Wtf. I had to format my hard drive. How do I recover my fucking certificate?
*Google's for a while*
No fucking way. I can't restore the certificate. Or get the keystore back. The solution is to create a new app with a brand new package name?
Thanks for nothing, I'm done with Android development.9 -
Hard drive head crashed and corrupted my entire android app source code which took my 5 months to build. I was depressed for 2 days and then started working for it again and updated the app on the store in 3 months. It was a terrifying yet amazing experience. Definitely don't want to go through that again.
Now I keep backups on the cloud. Lesson learnt.7 -
Ignore the code I know it's really basic but I didn't have my flash drive that has all my projects on it so enjoy the meme8
-
I have a guy sitting next to me in class. We were working on the same project. It's about rewriting a functioning mergesort algorithm in C and doing a presentation about that topic.
Now... the thing is that I was ill on that specific day when we got that project assigned. And he didn't tell me it either. I asked the whole class.
They just said that there was nothing special about that day. These fuckers.
Anyway...
Thé following week we had the same lesson again. Actually there were more than both of us. We were a group of 5 dudes.
3 of them barely have anything to do with programming at all. They just learn for the exams and have bad grades in programming.
Luckily, they already wrote the functioning sorting algorithm.
Since that is the case, I chose to review it to get deeper into that topic.
There were comments in English (we live in Germany) and these comments were written in a different style. My classmates would never comment in such a way.
It was a modified version copied from the internet. The whole source code.
The variables had names like j,k,b,u and so on. It was perfectly obfuscated.
Yesterday, I wasn't at college either.
I had to show up to a given time at a government bureau. They have been working on that project that day. So, I decided to ask them via a messenger, if they can give me the newest presentation files after 1 pm.
They said that they barely have anything to present. They would like to improvise they said.
"Fuck you all" I thought.
I'm done with these fucking illiterate humans.
I hope they all die in hell with satan having a ride on them. Stabbing them from behind right into their assholes and eating their ball sacks (if they have any).
Today is the presentation.
That's when I decided not to drive there during these specific lessons.1 -
Step 1. Learn to code .
Step 2. Exchange code for money.
Step 3. Exchange money for car, soap & a clean shirt.
Step 4. Profit.
[GOTO: Step #1]
Lol. OK on a serious note coding improved my love life, it drastically reduced the frequency of dates - but dramatically improved the quality and duration of my relationships.
I used to believe that anyone/thing had the potential to be great - and (like me) all they needed was a little time to seize an opportunity.
This essentially meant there were no deal breakers and I spent a lot of time giving people benefit of the doubt and investing a lot of time & effort supporting and trying to build on aspirations that would turn out to simply be fantasies I was indulging.
I still idealistically believe that everything/one has infinite potential - only now I know which problems are worth solving, which are purely for fun or a thought experiment and which should immediately be thrown out and refactored.
All the ambition in the world is void without drive.1 -
I don't pay much attention to my local file system when developing-- that's what my operating system and IDE are for. ...So I've thought, at least.
Today, my code didn't compile. I'd been noticing some pesky 'running out of memory' notifications, and mostly brushed them aside. I've spent the last hour deleting various log files and defragging the drive. -
I promised a friend to have a look over his dads website to add a small blog. No big deal, I've got it on my drive, can reuse it just need to adapt it to the environment.
I take a look at what I'm working with and I see the most terrifying piece of "Please, take my data" code I could possibly imagine (And I've seen passwords, in plain text in a script tag). I quote "function queryDB(mode, val) {
var query=" ";
if(mode==="findProd")
query="Select * from Products where ProdNam=" +val;
... (same shit for different cases)
sendQuery(query) ;
}
He literally built the query on the client side sent it to a php script (without validation) and inserted it into the database.
You could literally call window.sendQuery with any sql query and get the result printed into the console.
And other than the plain text passwords guy that wasn't some kid someone knew, this was a "Webdesign" Agency.
Now I took the entire thing offline, called my friends dad, explained it to him and try to sort this out. I would not charge a good friends father but that hack will get a quite hefty bill since my hourly rate just tripled.
And the worst thing : If I publicly name that asshole or warn the people in his portfolio I can, according to Google, be sued. (But, and I assume thats vague enough not to count as bad mouthing, if anyone of you has a customer from Rheinland-Pfalz, Germany with a preexisting page, please have a look at the database interface)
I will call that agency tomorrow, ask for a detailed explanation for why they apparently let trained monkeys write their code and anonymously warn everyone in their portfolio about those flaws...
I don't know if I'm cursed or if there are just that many bad devs but it seems that once a year I have to stumble over some "mistakes" that make me question my sanity.4 -
Spent 12 hours getting deep into a heavy new feature for a client based on Google Drive integration.
Find out at the code review the next day that the specs i was given were totally wrong and all Google Drive integration is being dropped.1 -
Next week I'm starting a new job and I kinda wanted to give you guys an insight into my dev career over the last four years. Hopefully it can give some people some insight into how a career can grow unexpectedly.
While I was finishing up my studies (AI) I decided to talk to one of these recruiters and see what kind of jobs I could get as soon as I would be done. The recruiter immediately found this job with a Java consultancy company that also had a training aspect on the side (four hours of training a week).
In this job I learned a lot about many things. I learned about Spring framework, clean code, cloud deployment, build pipelines, Microservices, message brokers and lots more.
As this was a consultancy company, I was placed at different companies. During my time here I worked on two different projects.
The first was a Microservices project about road traffic data. The company was a mess, and I learned a lot about company politics. I think I never saw anything I built really released in my 16 months there.
I also had to drive 200km every day for this job, which just killed me. And after far too long I was finally moved to the second company, which was much closer.
The second company was a fintech startup funded by a bank. Everything was so much better than the traffic company. There was a very structured release schedule, with a pretty okay scrum implementation. Every team had their own development environment on aws which worked amazingly. I had a lot of fun at this job, with many cool colleagues. And all the smart people around me taught me even more about everything related to working in software engineering.
I quit my job at the consultancy company, and with that at the fintech place, because I got an opportunity I couldn't refuse. My brother was working for Jordan Belfort, the Wolf of Wallstreet, and he said they needed a developer to build a learning platform. So I packed my bags and flew to LA.
The office was just a villa on the beach, next to Jordan's house. The company was quite small and there were actually no real developers. There was a guy who claimed to be the cto of the company, but he actually only knew how to do WordPress and no one had named him cto, which was very interesting.
So I sat down with Jordan and we talked about the platform he wanted to build. I explained how the things he wanted would eventually not be able with WordPress and we needed to really start building software and become a software development company. He agreed and I was set to designing a first iteration of the platform.
Before I knew it I was building the platform part by part, adding features everywhere, setting up analytics, setting up payment flows, monitoring, connecting to Salesforce, setting up build pipelines and setting up the whole aws environment. I had to do everything from frontend to the backest of backends. Luckily I could grow my team a tiny bit after a while, until we were with four. But the other three were still very junior, so I also got the task of training them next to developing.
Still I learned a lot and there's so much more to tell about my time at this company, but let's move forward a bit.
Eventually I had to go back to the Netherlands because of reasons. I still worked a bit for them from over here, but the fun of it was gone without my colleagues around me, so I quit last September.
I noticed I was all burned out, had worked far too much, so I decided to take a few months off and figure out what I wanted to do with my life. I even wondered whether I wanted to stay in programming.
Fast forward to last few weeks. I figured out I actually did want to work in software still, but now I would focus on getting the right working circumstances. No more driving 3 hours every day, no more working 12 hours every day. Just work close to home and find a company with the right values.
So I started sending out resumes and I gave one recruiter the chance to arrange some interviews too. I spoke to 7 companies in the span of one week. And they were all very interested. Eventually I narrowed it down to 2 companies and asked them for offers. And the company that actually had my preference offered me significantly more than I asked for, which settled the deal.
So tomorrow I'm officially signing with them, and starting next week I'll be developing in Kotlin, diving into functional programming and running our code in serverless environments. I'm very excited! -
I literally only wrote one line of code today. Don't ever start your day off by saying, "I think I'll make a quick backup of my primary hard drive."1
-
TL;DR: I'm stressed out over choosing a side project because of the commitment and fear of failure :(
I'm a student and summer vacation starts in 3 days (and actually has already started for me, thanks to a "smartly planned" hospital stay), so I'm currently looking for a cool project to start. This will be my third summer vacation during which I want to make complete a project, and I never actually did it. The first year, I couldn't think of any reasonable, doable project which would be interesting and fitting for the time scope (I was quite new to programming back then, so I probably couldn't have done things that would be interesting to me, an any project that I could've done would just take 20 minutes, cause I wouldn't understand anything more complex). The second time, I chose a project too big with too much new things I had to learn on the go. I actually pushed through for nearly a week, but then I realized that I only completed like 25% in that time, so I lost my motivation, thinking I could never finish it, while not wanting to start a complete new project, because that would've felt like wasting the time I put into my first project. It was still a valuable project and I learned a lot by doing it, but this year I want to actually finish a project; so I'm really stressed out right now trying to come up with a good project.
Usually I have millions of vague ideas in my head, but as soon as it comes to choosing, every single one seems to be the wrong one, or I forget about all of them. Everything that kinda interests me seems way to big and complicated to me, but I sometimes feel like I'm just underestimating my abilities, but on the other hand I have ~25 projects on my hard drive, of which 4 or 5 are finished and most will never be finished. :/
And it's just so overwhelming to choose something like that, because on one hand I really want to do a bigger project that I actually finish, and summer vacation is the only time I have so much time to code, and I love coding, but on the other hand choosing such a project that I will work 2-3 weeks on is too much commitment and also I'm anxious about failing it and never finish it, just abandon a buggy mess. Am I the only one to feel that way, or are you too having problems choosing side problems?
And, I guess if you have any ideas for a suitable project (literally anything, so that I might be exposed to some new ideas), just comment it.14 -
tell my boss on Friday that I'll work through the weekend to get done work done on some python code.
he doesn't give out vpn access so I can't use our company git so I put the project on a flash drive to work on.
come into work and I have an email. on Sunday he did everything I said I was doing (and had done) and then refactors the entire repo so even if he hadn't done the work, all of what I did became useless.
His way is the only way. but good luck getting him to tell you how he wants it. you just have to do a bunch of work only for him to tell you he doesn't like the way you did things and then he does it himself.
makes me realize why their other programmers didn't stick around. because they had to work so closely with this guy.
glad I started looking for other jobs sooner then later.1 -
I remember the first time I was experimenting with Linux and decided to install Kali Linux (was still version 1 at the time) and in the process cleaned my hard drive. I was in first year and I hadn't been introduced to git, so you can imagine what happened to my code.
Or when I dumped all my databases into one SQL file (the feature looked tasty in phpmyadmin) and then after reinstalling everything, I couldn't import back the files.
Or last year, where I was on industrial attachment. So we were to delete some data from DHIS2 manually. So as a developer I grouped all organisation units to be deleted under one parent and wrote a python script to recursively delete anything in that group. Just when I was about to show my supervisor how efficiently my script was deleting stuff, he said, "Don't delete anything yet". I hope he doesn't read this *wink*
Fast forward, last week on Friday I dropped my external hard drive. It just works on one USB port now, no idea how and why. -
What was the most rubbish developer you had worked with?
I will go first , once I worked with a Dev who used dashes for naming variables (eg _ = 'a' , __ = 'b', ___='c'), placing every everything in the main class . We were working on android (java) project back then. He decided to place everytime in the main activity, rewriting redundant functions. And he never use git, he literally use hard-disk and Google drive to back up his code which made us difficult to know which part of code he wrote. I quit working there because he was the Senior Project Manager.6 -
Sorry, need to vent.
In my current project I'm using two main libraries [slack client and k8s client], both official. And they both suck!
Okay, okay, their code doesn't really suck [apart from k8s severely violating Liskov's principle!]. The sucky part is not really their fault. It's the commonly used 3rd-party library that's fucked up.
Okhttp3
yeah yeah, here come all the booos. Let them all out.
1. In websockets it hard-caps frame size to 16mb w/o an ability to change it. So.. Forget about unchunked file transfers there... What's even worse - they close the websocket if the frame size exceeds that limit. Yep, instead of failing to send it kills the conn.
2. In websockets they are writing data completely async. Without any control handles.. No clue when the write starts, completes or fails. No callbacks, no promises, no nothing other feedback
3. In http requests they are splitting my request into multiple buffers. This fucks up the slack cluent, as I cannot post messages over 4050 chars in size . Thanks to the okhttp these long texts get split into multiple messages. Which effectively fucks up formatting [bold, italic, codeblocks, links,...], as the formatted blocks get torn apart. [didn't investigate this deeper: it's friday evening and it's kotlin, not java, so I saved myself from the trouble of parsing yet unknown syntax]
yes, okhttp is probably a good library for the most of it. Yes, people like it, but hell, these corner cases and weird design decisions drive me mad!
And it's not like I could swap it with anynother lib.. I don't depend on it -- other libs I need do! -
A long long time ago ( 2007 I think ) I worked for a company that made landing sites, so basically an email campaign would go out, users would be sent to a 1 page website with a form to capture their data, ready to be spammed even more. You know how it was back then.
So I worked with a guy who we had just hired, I didn't do the hiring but his CV checked out, so I gave him one of my tasks. Now most pages were made with js and html, with a PHP backend ( called with Ajax). Now this guy didn't know PHP so I was like all good, ASP works too at the end of the day we don't judge, we do like 2 or 3 of these a day and never look at them again. So he goes of and does is thing.
3 weeks later, the customer calls up to me they still haven't received their landing page. Ok so he probably forgot to email the customer np, I tell him to double check he has emailed the customer. Another week goes by end the customer calls back, same problem. At this point I'm getting worried, because we're days away from the deadline and it was originally my task.
So I go back to the guy and I tell him I want that landing page so I can send it myself, half thinking to myself that we had a freeloader, that guy that comes in to companies for 3 weeks, doesn't work, but still cashes his pay. But no, this was much worse.
So he tells me he has finished yet. I ask him why, what's the blocker ? You had 4 weeks to tell me you were blocked and couldn't progress. And his answer was simply, because I wasn't blocked I have been working on it this whole time. So I tell him to zip his project up and email it to me. We didn't do SVN or git back then, simply wasn't worth it. So he comes back to me and says the email server is telling him attachments can't be bigger then 50mb. At this point I'm thinking he didn't properly sized the art or something, so I give him a flash drive to put it on.
When I then open the flash drive, the archive is 300mb, thinking to myself, the images weren't even that big to begin with.
So I open it up, and I don't even find any images, just a single asp page. About 500mb. When I opened that up and it finally loaded, I saw the most horrendous things ever.
The first 500 lines was just initializing empty vars. Then there was some code that created an empty form with an onChange event that submits the form. After that.. it was just non stop nested if's. No loops, no while, for, foreach, NO elseif's, just nested if's, for every possible combination of the state the form could be in. Abou 5000 of them, in a single file. To make matters worse, all the form ( and page ) layout was hardcoded in the if's. Includes inline css, base64 encoded images, nothing but as dynamic, based on the length of the form he changes the layout, added more background etc. He cut the images up for every possible size of the page and included them in the code.
I showed it to my boss, he fired the guy on the spot. I redid the work from scratch, in under 4 hours. Send it to the client. they had no ammends to make, happy as Larry. Whish I kept the code somewhere.
Morale of the story, allways do a coding test on interviews, even if small things just to sanity check.2 -
Sometime in the mid to late 1980's my brother and I cut our teeth on a Commodore 64 with Basic. We had the tape drive, 1541 Disk Drives, and the main unit and a lot of C64 centric magazines my dad subscribed to. Each one of the magazines had a snippet of code in a series so that once you had 6 volumes of the magazine, you had a full free game that you got to write by yourself. We decided to write a Hangman game. Since we were the programmers, we already knew all the possible words stored in the wordlist, so it got old quick. One thing that hasn't changed is that my brother had the tenacity and mettle for the intensive logic based parts of the code and I was in it for the colors and graphics. Although we went through some awkward years and many different styles and trends, both of us graduated with computer science degrees at Arkansas State University. Funny thing is, I kept making graphics, CSS, UI, front end, and pretty stuff, and he's still the guy behind the scenes on the heavy lifting and logical stuff. Not that either of us are slacks on the opposite ends of our skilsets, but it's fun to have someone that compliments your work with a deeper understanding. I guess for me it was 2009 when I turned on the full time DEV switch after we published our first website together. It's been through many iterations and is unfortunately a Wordpress site now, but we've been selling BBQ sauce online since 2009 at http://jimquessenberry.com. This wasn't my first website, but it's the first one that's seen moderate success that someone else didn't pay the bill for. I guess you could say that our Commodore 64 Hangman game, and our VBASIC game The Big Giant Head for 386 finally ended up as a polished website for selling our Dad's world class products.1
-
Disclaimer: I hold no grudges or prejudices toward [CENSORED] company. I love the concept of the business model and the perks they pay their employees. Unfortunately, the company is very petty, and negligence is the core of the management. I got into an interview for the position, of Senior Software Engineer, and the interview wouldn't take place if wasn't for me to follow up with the person in charge countless times a day. The Vice President of Engineering was the most confused person ever encountered. Instead of asking challenging questions that plausibly could explain and portray how well I can manage a team, the methodology of working with various technology, and my problem-solving skills. They asked me questions that possibly indicated they don't even know what they need or questions that can easily get from a Google Search. I was given 40 hours to build a demo application whereby I had to send them a copy of the source code and the binary file. The person who contacted me don't even bother with what I told her that it is not a good practice to place the binary in cloud storage (Google Drive, OneDrive, etc) and I request extra time to complete the demo application. Since I got the requirement to hand them the repository of the codebase, it is common practice to place the binary in the release section in the Git Platform (Jire, Azure DevOps, Github, Gitlab, etc). Which he surprisingly doesn't know what that is. There's the API key I place locally in .env hidden from the codebase (it's not good practice to place credentials in the codebase), I got a request that not only subscript to an API is necessary but I have to place them in the codebase. I succeed to pass the source code on time with the quality of 40 hours, I told him that I could have done it better, clearer and cleaner if I was given more grace of time. (Because they are not the only company asking me to write a demo application prior to the assessment. Extra grace was I needed)
So long story short, I asked him how is it working in a [CENSORED] company during my turn to ask questions. I got told that the "environment is friendly, diverse". But with utmost curiosity, I contacted several former employees (Software Engineer) on LinkedIn, and I got told that the company has high turnover, despises diversity the nepotism is intense. Most of the favours are done based on how well you create an illusion of you working for them and being close to the upper management. I request shreds of evidence from those former employees to substantiate what they told me. Seeing the pieces of evidence of how they manage the projects, their method of communication, and how biased the upper management actually is led me to withdraw from continuing my application. Honestly, I wouldn't want to work for a company where the majority can't communicate. -
Question about burnout here!
I've been a developer for a year and a half now and I've reached a point of burnout. Experiencing a lot of external stress as well as internal (handled well with a fantastic and supportive team)
I'm taking some time away from work and having a much needed break but I'm worried that for now, I can't code! I've got no drive at all to learn anything new, I'm just sat here waiting for a production push.
I'm by no means thinking of changing careers or leaving my current role and the lack of concentration is likely as a result of stress, I just wanted to hear some of your stories so I feel a little less alienated!
Being new to this is pretty overwhelming at times!3 -
Not really a rant but more of a fact kinda thing. Noticed a post earlier about someone ranting about why they code figured I'd do the same...
I code not because I wanted to for say but because my after my uncle's death I needed something that I could feel in complete control of. Coding gave me that ability to control the computer however I want and tell it to do whatever however. At the same time it taught me so much more about myself and the people around me in the process. Today I don't code because I need to control something m today I do it because I can't live with out. It forces me to think critically of everything and everyone. It forces me to learn something new everyday and every night. It requires me to solve complex problems with limited solutions. It allows me to create solutions when everything else has failed and it gives me a drive to complete things. It's the reason I live technology and it's the reason I have the job I do. It's the reason my boss loves my work and it's the reason other people on my team envy me. Code transformed my life into what it is today. And it will forever be my greatest peice of education.1 -
Best: Realising I can code and I actually do have the drive to pursue this career but need to make some changes to get there.
Worst: Also realising I'm very logic oriented and process driven and work in a company that would rather piss on exposed power mains over training their staff. -
I'm working in a complex CMake/C++14 project.
Many libraries uses EASTL as STL replacement, works and compiles flawlessly.
Have to use Qt5 for an application which uses the libraries.
The EASTL Library fucking collapses
Compile fails, 1k of syntax errors somehow.
After hours trying to figure out without alterating the EASTL library (i don't want to maintain custom versions of 3rd party libraries, an complete burden to maintaining updated)
Remove all reference of Qt5 from the code and the build system.
It fucking compiles.
Isolate an minimal build which only uses CMake, EASTL and Hello World in Qt5.
1k of syntax errors again.
Spend hours trying to fix it, no avail, still fucking 1k syntax errors.
I'm past beyond of the project development where ALL the big libraries of the project uses EASTL extensively.
One day C++ will drive me into the depths of madness.2 -
Hitting a really deep, deep low in the manic-depressive roller-coaster of the development cycle:
There comes the crunch time. No meeting goes by hearing the odious: "We don't have time for that." - One critical component needs to be finished for Big Sur and instead of addressing the real issues we keep changing design and goal. One main dev already gave up fighting the PO and team lead(!) - and now I'm next. So that dev build this really clean and minimal library as the core part. But now it's just like, yeah, take that nice Porsche engine put it on the old rusty bicycle from the shed,.. but maybe because that's so shitty we need that specially formed exhaust pipe to tune it. Yeah, very 'agile' - Only thinking about it makes me shudder in disbelief and anger. I shouldn't take that shit so serious, be emotional about shit code, I know, but I can't. Let them drive some rounds around the block, if it runs at all,.. because until now we still didn't make it run on the fuckin' street. It's all so insane. Will make some nice fireball, when it goes up in flames.
Well, I have been part of quite some shitty projects. Real suicide commandos set out to fail, and somehow stood them through or made it even "work" though it should never have. But what enrages me here is, that it needn't to be that way. We had plenty of time. Our team was often rowing along in good rhythm. And now I just feel drowned in resignation and sarcasm.rant fuck po resignation crunch time shitty design manic-depressive sarcasm low roller-coaster low fail hard -
I work as pharmacist, but code as hobby and recently change job. Have far more options to improve work enviroment, but IT guy sucks balls so much.
Better no password, because you have to remember them.
Some users don't have privilages to do some things, but everyone knows boss password with all privilages.
It guys connects via teamviewet whn I check prescriptions with quite vulnerable data and after my step in he responds that he creates this Pharmacy store and has deal with boss to access database and others.
Due lack of controls there is working against law all the time
Small city so everyone knows everyone and you have to be ultra polite to doctors and after my little unpleasent situation doctor starts to be mad at all employers.
It guy was asked to change disc space on OS drive, but he replies that it will takie at least 2 hours and he doesn't have time, but it takes me 15min top and he was mad at me.
Ffffff.... -
So it's not just through reading your own code later that you can realize how stupid you are. All the great card house of the belief in your own superiority collapsing instantly.
Currently intense time with my son. Can be hard being around one another 24h non-stop... And then realizing that a lot of the stubbornness and quirks of his that drive me crazy: is actually me! (Be it that it's in my character as well or he was reacting to a stupidness of mine)2 -
Why use git, do it simple, send me your changes by email and I will merge it.
Why split split source code (js) into different files, use one so we will no have trouble about load order.
Use the same user account for github/gitlab/bitbucket/etc. So we will no worry to setup access permisions.
Use Dropbox/Drive for version control.
We will test the whole system until the end when all is finish.3 -
Not using github and keeping my finished projects somewhere for past 10 years.
I've started when I was 13, I'm 23 now and only recently have I started saving my code on an external drive, a cloud and on some on github.4 -
Randomly grabbed a open source project off github (zip didn’t use git. Didn’t wanna accidentally request a merge with my garbage code) after talking to the developer on discord about a feature I thought would be cool and he welcomed me to try adding it since he was busy bug fixing the latest release
Never seen the language before in my life (before I started college) and egotistically assumed I’d be able to learn enough to add what I wanted. I was horribly wrong. The farthest I got was potentially understanding how I’d be able to add it as well as getting a placeholder checkbox for the feature in the options form
Soon got discouraged and zipped up what I attempted and put it in my code graveyard on my archive hard drive for a future attempt -
This always gets me:
Developers complaining that their 4 year old / cheap ass computer is slow.
Get. A. New. One.
It's not that hard.
Here, let me do one for you:
https://computeruniverse.net/en/...
I just went to a site that delivers across Europe, and selected a cheap laptop with a decent CPU and SSD. Short on RAM, sure, and without a Windows License. But you can buy RAM for an additional 50$, and that brings you to a total of 550€, delivery included. And it will WORK. And it will be fast.
It's too expensive?
No, not exactly. Wherever you are in the world, if you can code decently, good enough to have the right to complain about development tools, you are eligible to at least 10$ per hour income as a freelancer across the globe. I've had such opportunities offered to me by many organizations, especially non-profit ones that need cheap employees. I actually was offered more but let's stick to 10$ per hour.
So that's 1600$ per month. Enough to buy 3 such laptops. Oh, taxes, I forgot. So you get 2 laptops. Wait! You need food and everything else. Well if you're in a country where that offer actually makes sense, then it's likely that you can live off of 400$ per month quite well. Maybe 800$ if you need to pay rent.
So that's roughly 1 month of work for a laptop that will make you not waste time on waiting for stuff.
Sweet! 1 Month! What does it get me?
Well assuming that you have no laptop, it gets you A JOB that pays you 1600$ per month.
But if you DO have a laptop, you can sell it for cheap, and benefit from the following:
1. Boot-up time from 30-60 seconds to 10 seconds.
2. Installing software - from 1 minute to 10 seconds.
3. Opening a browser - from 10 seconds to 1 second.
4. Opening an advanced text editor (Atom, VS.Code) - from 10 seconds to 1 second.
5. Searching for a file on your entire hard drive - from 1 hour to 2 minutes.
....
You get the point. Waiting is reduced by several times.
So how much do you really wait when coding?
Well are you compiling? Are you opening a new project and the IDE needs to re-index the files? Are you opening programs like a terminal emulator, browser and such? Are you using virtual machines for dev environments?
Well all of these processes become several times faster. Depending on how often you do it, you'll be saving yourself from 1 hour per day to upto 4 hours per day (my case, where a HDD would be just out of the question).
How much is that time worth? At least 10$ per day. If you're working for 20 days per month, 240 days per year, that's a total of 2400$. And for the life time of that crappy laptop of 2 years, that's 4800$ saved. And that's with hugely conservative numbers. Nobody pays 10$ per hour any more, except if you've just started in the industry. I know because I've been there.
Please, for all that's sacred to you, justify right here, right now, HOW THE FUCK can you not afford to get that 8GB of RAM, that cheap ass SSD for 100$, or even a brand new laptop (hey! it's even portable and has FHD graphics on it!) for 550$.
That's why every time I hear someone who is a professional developer complain that they don't have money for a decent machine, I have to ask: why the fuck are you wasting yours and everyone else's time?!10 -
PC setup upgrade
I'm making baby steps, at least I can boast of a very standard PC and write code in peace and use all that screen real estate to my advantage
looking back at two years ago when I was crying and begging my parents for just a core 2 duo laptop that I could learn programming with,
now I almost have all that is needed and an even stronger drive to push my limits and become a better programmer
yes, the kind of PC makes a lot of difference when writing code.
I'm still unemployed and relying on small side contracts but it's still a big step and a consolation for me when I consider the crap I have been through for years
I'm not stopping, higher we go6 -
Oh boy!
Aren't we off to a fucking great start, first turn on my Xbox and it keeps overheating...
Ok I'll leave it for a bit and just jump on my PC and do some work but nooooooooo. Boot it up and it fucking hangs on an A2 boot code (Drive issue), unplugged every drive and look at that, still on fucking A2...
I do not need this right now. Can't afford a new fucking PC if this one is going to be fucking up like this -,-2 -
Looking through a former developer's drive for their projects folder is kind of like a treasure hunt, only you don't get something good at the end of it usually.
Especially when there's a good reason they're a "former" developer.
Non-standard locations.
Behold, latest deployed code changes are uncommitted.
Alcohol, please save me.2 -
We've got a big legacy app which we have to rewrite. The current client applications are only working on XP(!). We have to move the clients to the browser so we can finally get rid of all XP vm-s. The db schema is complex but still 1000+ stored procedures and functions and about a hundred tables with 13 years of data.
So I ask the guy responsible for maintaining the DB code. (he is ~25 years older than me)
me - Where is the source of the database. Which project?
he - Where would it be? It's in the db.
me - So we've got a huge db without VCS, upgrade/downgrade scripts, etc?
he - Yes. I don't get why young developers always want to use shiny new tech like git just because it is cool. It has nothing that an external usb backup drive can't do.
me - VCS has been around since the early 1980's...
he - If you really want, you can put it under git or whatever, so you can sleep better, but I still think it is stupid and a waste of time.
I get that it's hard to keep up, but getting personal... -
A couple nights ago I was thinking how can absurdly incompetent programmers exist out there (based on stories I read here), and I think I know the reason. They just don't like doing it, to them it's just a job. They get into the building, work and go home. They learned programming in college but probably never wrote anything for fun. Because of that they don't dedicate themselves to learning new tech, don't try to improve and be good at the job, all they want is the money to be able to survive and that's it. Since they don't have the curiosity to drive them forward, they just don't and keep writing shitty code.
I'm not saying you need to have a bazillion side-projects, work an 8h shift and then go home and spend 3h on personal projects, or that you have to breathe programming and tech. All I'm saying is that, to be competent and good (this probably applies to most jobs) you have to like what you do and have at least some interest in it.7 -
go fuck yourself with your fucking communities. i went into computing because i like being left alone. who are all those fucking freaks building their communities? this is capitalism mother fuckers, everybody in the world agreed on it, on each person being an independent individual doing their job to the best possible standard, instead these low-skill low-iq oversocialised sheeple started conglomerate into communities and brainwash everybody that this is what it is about. get stuffed alright. all my life i've been introverted, just leave me alone to write code alright? take my library i don't mind i'll take yours no strings attached, just push the code and forget about it. but no, all these degenerate morons without CS degrees have occupied our safe space, pushed us out of it and just can't get enough of using the buzzword "community-driven" "volunteers" volunteer my ass assholes you can't even make software nobody in real industry needs you because you have no skill at all you learn a bit of js which is any 14-15 yo can do and now think you're some kind of prodigies, unsung heros of humanity who selflessly bring the progress. nothing can be further from the truth - because of you we don't have real software, we don't have investment we don't get no respect everybody walks all over software engineers treating us like shit, there's an entire generation of indoctrinated parasitic scum that believes that software tools is grown for them on trees by some development teams that their are entitled to automatically, because some corporation will eventually support those big projects - yeah does it really happen though - look at svelte, the guy is getting 50k a year when he should be earning at least 500k if he had balls to start a real businesses, but no we are all fucking prostitutes, just slaving away for the army of people we never see. are you out of your mind. this shit should be fucking illegal alright it's modern day slavery innit bruh, if a company wants to pay their engineers to work on open source this is fine, i love open source like java or google closure compiler, but it's real software made by real engineers, but who are all these community freaks who can't spend a 10 seconds on stage in their shitty bogus conferences without ringing the "community" buzzer? you're not my community i fucking hate your guts you're all such dumb womenless imbeciles who justify their lack of social skill by telling themselves that you're doing good by doing open source in your free time - mate nobody gives a shit alrite? don't you want money sex power? you've destroyed everything that was good about good olde open source when it was actually fun, today young people are coerced into slavery at industrial scale, it's literally impossible to make a buck from software as indie unless you build something really big and good, and you can't build anything big without investment and who invests in software nowadays? all the ai "entrepreneurs" are getting fucking golden rained with cash while i have to ask for a 5$ donation? what the actual fuck? who sanctions this? the entire industry is in one collective psychotic delusion, spurred by microsoft who use this army of useful idiots to eliminate all hounour dignity of the profession, drive the abundance and bring about poverty of mind, character, as well as wallet as the natural state of things. fucking amatures of course you love your shitty little communities because you can't achieve anything on your own. you literally have no personality, just one homogenous blob of dumb degenerates who think and act all the same. there used to be a tool called adobe flash builder, i could just buy it, then open and make a web app, all from start to finish in one program, using tutorials of adobe experts on youtube, sure it might have had its pitfals but it was a product - today there's literally no fucking product to make websites. do you people get it? i can't buy a tool that i need to do my job and have to insult myself by downloading some shitty scripts from some shitty unemployed devs and hope my computer doesn't blow up in my face in the process because some freak went off his nut and uploaded some dodgy ass exploit on npm in his package. i really don't like. it's not supposed to be like that. good for me i build by own front/back end. this "community" insanity is just a symptom of industrial degeneration, they try to sell it to us like it's the "bright" communist future but things never been worst, i can't give a shit about functional programming alright i just need to get my job done mate leave me alone you add functional because you don't know how to solve the problem properly, e.g., again adobe flex had mxml where elements had ids and i could just program to id, it was alright but today all this unqualified morons filled the whole space after flash blew up and adobe execs axed flash builder instead of adapting it to js runtime, it was a crime against humanity that set us back to 1000s4
-
So a trainee made a website at the company where I also have my internship, he finished his internship earlier than I did. But the problem is I'm now fixing his site and it's literally falling apart! I fixed one problem and a dozen apear! His code is the definition of spaghetti code. It's so extremely bad I can't handle this, I don't want to do this anymore, just someone please drive a knife trough my chest. This is unbearable HE CREADED A HTML PAGE INSIDE ANOTHER ONE flipping heck how could you think that's how things work!1
-
I am already tired before even looking at this code.
Looking at your code makes me cry.
I can insult myself whole day but it won’t be enough to survive looking at your coding style.
If cpu could talk it would ask for heater removal because your code depresses it so much.
Looking at your code makes my monitor burn out.
Downloading your code makes my hard drive stop.
And my favorite:
You’re already good developer so now stop writing and appoint as manager / tester. -
Sometimes I feel like, if anybody would have told me, the real use of GitHub, bitbucket or any other version control systems. Then life would have been much easier.
I remember in my college days, I use to keep the code backup in several different places on my system as well as Google drive and Dropbox..
For working parallely with the team-mate in college means...sharing of changed code..every now and then..via mail😫
Git, bitbucket you're the real MVP. Period.2 -
Why are you trying to multithreaded c++ file i/o? If you can't write c++ code that's faster than your hard drive, please just don't write c++.
Literally no complex calculations, just some insane string formatting.7 -
I'm officially at a point of writing software that I know this snippet of code will be absolute hell for the next developer to maintain.
Doesn't matter how well I document it, doesn't matter how well I break down the problem.
The `why` of the problem is gonna drive the maintainer crazy later. The most dangerous part, it might as well be me in the coming months.
RIP the next developer, who will have to maintain my spaghetti (includes me). -
The bug I never fixed isn't a bug in code I wrote, but rather an OS problem I've given up on fixing.
I dual-boot Windows and Linux on my desktop PC. Every time Windows updates, it switches from grub to the Windows bootloader, making it impossible to boot into Linux. I've fixed it three times (each time requiring a different fix, from disabling fast startup to reinstalling Grub from a live USB), then gave up. My desktop PC is now a Windows machine. I'm upgrading some parts soon (including replacing my boot drive with an NVMe SSD) so I decided when I do that, I'm just going to reinstall Linux on the new drive and see how long I can last without installing Windows at all.3 -
I had to make a project for university with a colleague and we shared code through google drive because none of us never used git.
Don't insult me too much please 😂 -
if (rant !== story)
System.out.println("Dev rant story time")
A coworker mentioned to me that I might have depression as part of my personality. They think this because I always feel at my best when I'm being active/productive (programming) or doing meditation practice. I thought that was strange.
Bit of a brief background, I've had depression since I was about 12 and I still get small bouts of it into my late 20's. I've been on antidepressiants for a very short time and I've been through talk therapy multiple times. It was a lot worse then it is now and I believed I have it under control.
My coworker thinks that I ended up dealing with it for so long that it has become a part of my personality so I don't notice it actively. The whole thing has left me sort of, I don't know, jaded. Or maybe just afraid that it could be true?
I thought about how I have a very all or nothing attitude in life. I don't think about getting a house because I don't put too much faith in myself towards having a family. Or how I have to make very radical changes to my life immediately if something starts triggering the new depressive episode. If I can't code or read at night I'll hope in the car and drive with no destination in mind for several hours just to keep my mind at ease.
I don't know. It sorta upsets me because I always thought of depression as something you need to "get out of", but now I wonder if my case was severe enough that I've adapted my life around it.9 -
I'm really trying my best to improve but the work I'm doing (both the code and the business theme) is so god damn boring that I feel like I'm torturing myself just trying to keep up. How am I supposed to learn and build myself when everything is so dull and gray? I can't even talk semi-passionately about the work I do, its all just picking up user stories with lengthy business specs on them updating old code or writing up some new code to fit some business / API standard I know nothing about. Occasionally I'll review other code from a developer doing the same thing and sift through trying to find some way to improve a project I don't care about. Hold down the nausea that comes from fighting off the mental fatigue as I struggle to find the words to explain how a component I made works in terms I don't understand too people that know and care much more than I do...
I'm exhausted, I'm burnt out. This isn't me, and every day I wake up and tell myself that my salary makes me happy because it gives me the ability to do the things I enjoy and live on my own and provide for loved ones, and then struggle to swallow the lump in my throat as I drive in the cold to a giant corporate office with a thousand other Me's doing the same shit but better and improving.
I honestly love what my company offers me as compensation, I'll likely not find any better. But once I have some experience under my belt and some debt paid off I have GOT to find a jobs somewhere that doesn't drain the will to live out of me2 -
When a friend told you that they have a problem and needs a Computer Science student's help ..
.. and it's about a broken flash drive.
I can't even fix my broken C code let alone fix a freaking flash drive.1 -
We work in VDI environment, that likes to nuke itself randomly and takes with it all the hardwork for the week.
I came up with one solution -
Name - Fsync.sh
Task - backs up all your work to a common shared network drive. This backup is in deltas to reduce network load and to save space.
How? I used git!
It gets the code changes from existing cloned repos & it git inits in folders like Documents & downloads.
Git tracks the changes for me :D3 -
What do you think I code for? So I can drive a f@#$ing Rav4?
- paraphrased from a Kanye West rhyme.2 -
A file that I had copied from the company network drive into my own. VS Code to edit the content according to a tutorial provided. IDE doesn't work with the given file, dependencies not resolvable, so let's troubleshoot. Open the file in question inside the IDE, the file contents are those from the tutorial?? Turns out I didn't edit the file on my own system but on the network drive. At least it wasn't a critical file. 🤦
-
Sometimes in our personal projects we write crazy commit messages. I'll post mine because its a weekend and I hope someone has a well deserved start. Feel free to post yours, regex out your username, time and hash and paste chronologically. ISSA THREAD MY DUDES AND DUDETTES
--
Initialization of NDM in Kotlin
Small changes, wiping drive
Small changes, wiping drive
Lottie, Backdrop contrast and logging in implementation
Added Lotties, added Link variable to Database Manifest
Fixed menu engine, added Smart adapter, indexing, Extra menus on home and Calendar
b4 work
Added branch and few changes
really before work
Merge remote-tracking branch 'origin/master'
really before work 4 sho
Refined Search response
Added Swipe to menus and nested tabs
Added custom tab library
tabs and shh
MORE TIME WASTED ON just 3 files
api and rx
New models new handlers, new static leaky objects xd, a few icons
minor changes
minor changesqwqaweqweweqwe
db db dbbb
Added Reading display and delete function
tryin to add web socket...fail
tryin to add web socket...success
New robust content handler, linked to a web socket. :) happy data-ring lol
A lot of changes, no time to explain
minor fixes ehehhe
Added args and content builder to content id
Converted some fragments into NDMListFragments
dsa
MAjor BiG ChANgEs added Listable interface added refresh and online cache added many stuff
MAjor mAjOr BiG ChANgEs added multiClick block added in-fragment Menu (and handling) added in-fragment list irem click handling
Unformatted some code, added midi handler, new menus, added manifest
Update and Insert (upsert) extension to Listable ArrayList
Test for hymnbook offline changing
Changed menuId from int to key string :) added refresh ...global... :(
Added Scale Gesture Listener
Changed Font and size of titlebar, text selection arg. NEW NEW Readings layout.
minor fix on duplicate readings
added isUserDatabase attribute to hymn database file added markwon to stanza views
Home changes :)
Modular hymn Editing
Home changes :) part 2
Home changes :) part 3
Unified Stanza view
Perfected stanza sharing
Added Summernote!!
minor changes
Another change but from source tree :)))
Added Span Saving
Added Working Quick Access
Added a caption system, well text captions only
Added Stanza view modes...quite stable though
From work changes
JUST a [ush
Touch horizontal needs fix
Return api heruko
Added bible index
Added new settings file
Added settings and new icons
Minor changes to settings
Restored ping
Toggles and Pickers in settings
Added Section Title
Added Publishing Access Panel
Added Some new color changes on restart. When am I going to be tired of adding files :)
Before the confession
Theme Adaptation to views
Before Realm DB
Theme Activity :)
Changes to theme Activity
Changes to theme Activity part 2 mini
Some laptop changes, so you wont know what changed :)
Images...
Rush ourd
Added palette from images
Added lastModified filter
Problem with cache response
works work
Some Improvements, changed calendar recycle view
Tonic Sol-fa Screen Added
Merge Pull
Yes colors
Before leasing out to testers
Working but unformated table
Added Seperators but we have a glithchchchc
Tonic sol-fa nice, dots left, and some extras :)))
Just a nice commit on a good friday.
Just a quickie
I dont know what im committing...3 -
Long post, TLDR: Given a large team building large enterprise apps with many parts (mini-projects/processes), how do you reduce the bus-factor and the # of Brent's (Phoenix Project)?
# The detailed version #
We have a lot of people making changes, building in new processes to support new flows or changes in the requirements and data.
But we also have to support these except when it gets into Production there is little information to quickly understand:
- how it works
- what it does/supposed to do
- what the inputs and dependencies are
So often times, if there's an issue, I have to reverse engineer whatever logic I can find out of a huge mess.
I guess the saying goes: the only people that know how it works is whoever wrote it and God.
I'm a senior dev but i spend a lot of time digging thru source code and PROD issues to figure out why ... is broken and how to maybe fix it.
I think in Agile there's supposed to be artifacts during development but never seen em.
Personally whenever i work on a new project, I write down notes and create design diagrams so i can confirm things and have easy to use references while working.
I don't think anyone else does that. And afterwards, I don't have anywhere to put it/share it. There is no central repo for this stuff other than our Wiki but for the most part, is like a dumping ground. You have to dig for information and hoping there's something useful.
And when people leave, information is lost forever and well... we hire a lot of monkeys... so again I feel a lot of times i m trying to recover information from a corrupted hard drive...
The only way real information is transferred is thru word of mouth, special knowledge transfer sessions.
Ideally I would like anything that goes into PROD to have design docs as well as usage instructions in order for anyone to be able to quickly pick it up as needed but I'm not sure if that's realistic.
Even unit tests don't seem to help much as they just test specific functions but don't give much detail about how a whole process is supposed to work.9 -
Do you ever procrastinate getting into a project, at any phase, starting, mid code updates, etc,,, knowing it is not only going to take you time to get your head back into it, but you also know that once you do, and hopefully yes you get into a groove, that it requires a mental time commitment... that last word, commitment, I'm not quite sure if I'm ready to get into, commit to just yet, so, I start procrastinating by doing a whole list of small stuff I need to finish first, because god knows when I get into this thing, I won't be able to jump out and do anything else easily... and then let's say all that goes well,,, small stuff done, I've procrastinated long enough, now I'm ready to drive in, OK, here we go, 5 minutes of reacclimating myself, and someone walks in, wants my attention, which I can't give them, I've already started down this slippery slope... and somehow I come off rude if I don't acknowledge them....aaaggghhh...!4
-
The hotly debated topic that anybody can learn to code is always seems to devolve into a definitional or even epistemological argument to the point of being valueless. But I like to think about it like this:
Anybody can learn to code in the same way anybody can learn to drive. The most rudimentary of searches for 'dash cam fails' should provide some valuable context for the practical implications of this.7 -
The code I am supposed to refactor only builds if mounted on/as drive s:\.
Sure worked for the previous dev.
First thing to do: new makefile. And git init. -
I work on a small dev team. A team member recently left. My boss is lenient about committing our repos. ex co worker didn't commit his code and instead just left his code on a zip drive. Today I had to resolve nine months of conflicts and basically throw out all the work this guy had done.8
-
I just thought. The next generation of coders are going to curse the software we praise. Well be using JavaScript to drive cars and ATMs (if we aren't already). We're gonna talk shit to dev youngsters about compilers, shims and fucking cross browser compatibility and how good they have it. Some of us will be stuck in the past keeping bullshit legacy code alive. Besides that, the world is gonna be a fucking awesome place (rip Mahammad Ali)
-
I like to simrace. Its pretty relaxing to take my eyes of the code and to go for a drive, without wrecking my car 😂
-
So I am in a computer science class and we had a project. I was in a group of 3 people and since majority rules we were to make a game. However they have never ever done any ui work ever. So I was in charge of coding the entire game. And since they did not know how to use git we had to use Google drive to transfer code. But ling sorry short I switched on them and got an A and they had to redo it on their own.
-
A jr dev was having an issue registering code with our data pipeline (prefect self hosted).
Turns out he's running vscode to launch a anaconda shell (didn't even know that was a thing) to launch jupyter notebook and running commands in the notebook (didn't know that was possible) all from Windows.
No it doesn't work. His environment configuration isn't right. I told him to just run Linux and get rid of all that nonsense.
Nothing is on git yet and were three weeks in! His code is full of hard coded absolute paths of files on his hard drive... He even had an example app to go buy, with a project layout to copy.
There's no helping some people9 -
Can someone tell me why the fuck is it so hard to choose where to install electron apps? Selecting installation directory is a default feature in pretty much anything installable. Is electron somehow above that? Is clicking the two a extra buttons to choose a second drive too mainstream nowdays? What? Why? I use Atom, VS code, postman, cycligent, boostnote among others . The idea is good, the apps look beautiful and responsive. But bloated as fuck. Atom alone takes 1.4Gb! And I am ok with it! Really I am! But why the fuck not let me install it in a drive where I have 70% of space free and instead make me use my crammed SSD? Why? WHY?1
-
Back in 2005, I had quite a few bits of music I was working on (just as a hobby). A lot of these had not been finished, but I'd sent excerpts in medium-quality MP3 format to a friend. I had an external backup drive - a regular hard drive in an USB enclosure. After a while, this drive started making unpleasant whining sounds so I sent it off for replacement.
During that time I made the foolish decision to try and plug a floppy drive in while the PC was powered on. Something touched the bottom of the hard drive and the power went off. I powered it back on again and heard a fizzing sound, there were some flashes from the hard drive and a burning smell. Yep, the disk was dead - and my backup drive was gone.
I'm still not entirely sure what happened, my best guess is that I had an exposed piece of wire from one of my hacky case mods (I had a thing for blue LEDs) which touched the circuitry of the hard drive. Almost every project, piece of software I'd created, every photo I'd taken, and most unfinished music I'd made up until that point - gone. I was pretty devastated about it. I only had a handful of things survived which I'd burned onto CD previously.
I managed to get some excerpts back from my friend, and re-created my favourite pieces of music based on those. I've moved on to other projects and write much better code now, so mostly I am no longer bothered. I do wish I could re-listen to some of the music I had made back then though.
Needless to say, I no longer fiddle around with the innards of my computers while they are on, store everything on mirrored drives and also ensure I always have a backup somewhere (and am working on remote backups and having several days of backups...)
I never want that to happen again -
In college, during Novell's heyday, I was working on my Certified Network Administrator certification (totally worthless, in retrospect). As I was becoming an expert in all things Novell, I found a security flaw. Using Visual Basic it was possible to code up an exact replica of the Novell login screen that launched at boot time from a batch file stored on a floppy. You could log peoples' usernames and passwords all day as long as they didn't realize your floppy was in the drive, which worked in certain computer lab setups on campus. I wasn't in it for stealing info or being a criminal. I just did it for the lulz. But if I had gained access to a few of the right computers in admin offices on campus, I could've gotten access to anyone's student profiles and grades.
-
Maybe you people will like this story.
The past semester I studied Java in class. First time doing object oriented programming, I had an annoying teacher but got the hang of it. I still miss C from the last year.
As a final project we had to do any program and apply some stuff we saw in class (The program should have an array list, use interfaces, bla bla bla bery simple stuff). It also must have a complete documentation, a manual and a diary explaining what was developed every week. Bonus points if it was in a repository like GitLab.
I wanted to do an RPG game in a matrix, like a rougelike or an old FF game, that should be a map or two, a few monsters and items and that's it. Enough to show what can I do and to have enough excuses to apply everything that the teacher asked. I had a team with two friends who wanted to do the same.
After making accounts in three different pages that apparently would help us to be more organized (One to make charts and two task trackers) I lost all patience and made an account in GitLab, made the basic classes that we had defined in a chart, divided the tasks and put them in to do on GitLab and we started to work.
One of my companions caused a lot of problems. First, he didin't wanted to learn how to use GitLab (I simply asked them to do merge requests) and he insisted to use GitHub. Then he started to say that using the console version was even better (Pretty sure he said thet he never used Git, but maybe was gas poisoning). The GitLab repository never had a single commit to his name.
BUT WAIT IT GETS BETTER all the entire time, he was complaining about the graphical interface of the game, wanting to use some SDK for RPGs that he found. I told him that we will see that at the end, that first we should have all the mechanics done, test it in ASCII in the console and then, if we have time, we will put the visual interface, separated and optional from the main program to avoid problems.
After two weeks where he gave me very simple standard stuff late, half done and through Google Drive, I discovered he was most of the time working on... the graphical interface SDK! He took the job already done by me and the other guy and making a pretty hardcoded integration with the graphical interface and making everything that he tought it would be necesary. Soon enough the GitLab repository was totally outdated and completly useless. He had the totallity of the project in his half broken laptop, and sometimes he gave us a zip with all the code, outdated after a few minutes. Most of the stuff that I made was modified, a lot of the code was totally unknown to what it was and I had no idea even of how the folders were organised.
We had a month to finish it. I got totally disconected from the project and just hoped for the best, sometimes doing a handful of generic and adaptable lines of code for a specific thing (Funny enough, many core mechanics were nonexistent). The other guy managed to work more on the project, mostly fixing the mess that the guy did: apparently he didin't read the documentation of the SDK and just experimented and saw tutorials and tried to figure out how to do what he wanted.
Talking about documentation: we dont had yet. The code wasn't even commented propely. We did all that the last week and some stuff was finished the last night. The program apparently worked but I had no idea.
Thank God, the teacher just looked over everything and was very impressed by the working camera and the FF tiles. I don't think he saw the code or read too much of the documentation, much less when I directly wrote how I lost all access to the project.
I had a 10/10. I didin't complained. Most easy and annoying ten I ever had. I will never do a project with that guy. -
When you make a massive change to the code base and run the test suite to drive out functionality but nothing fails...
-
Working code?
Or fake compiler?
Fix a problem?
Or buy a new computer?
Bring a flash drive?
Or bring a hard drive?
Use water cooling?
Or use an ice cube on top a processor and memory?
Drink some coffee?
Or eat a healthy breakfast?
Do you make hardware?
Or software?
These are the problems programmers face from old people as employers or relatives trying to find something to relate to. -
So I have this habit of copying all my family pics and kids videos onto portable hard disks. Have a 500GB Western Digital since 2012 and another WD 1TB since 2016.
Had one portable HDD failure before that back in 2010, but that contained only old projects code {when I didn't know git} .
So any advice you guys have for me on managing backups of these life memories? I mean I don't trust cloud storage - Google Drive, DropBox etc. And don't want any 3rd party poking into my stuff. That's why these items go straight from Camera to HDD.
What should I do to prepare for another failure? And is there any kind of RAID available in the form of portable solution?
Is it a good idea to change HDD every 5 years or so?8 -
A follow-up to a previous rant: https://devrant.com/rants/2296700/...
... and how the senior dev recently took it up a notch.
To recap: Back then the senior dev in our two-man project prepared tasks for me so thoroughly they became typing monkey jobs. He described what to do and how to do it in minute detail in the JIRA tasks.
I talked to him back then how this is too detailed. I also talked to our boss, who agreed to nudge mr. senior in the right direction and to make it clear he expects teamwork.
Fast forward to a couple of days ago. An existing feature will get extended greatly, needing some rework in our backend project. Senior and me had a phone call about what to do and some unclear details in the feature spec. I was already frustrated with the call because he kept saying "No, don't ask that! That actually makes sense, let's just do it as the spec says" and "Don't refactor! We didn't request a budget for that from our customer". Like wtf, really? You don't consider refactoring part of our job? You don't think actually understanding the task improves the implementation? Dude...
We agreed this is a task for one person and I'd do it. It took me the rest of the day to wrap my head around the task and the corresponding existing code. It had some warts, like weird inheritance hierarchies and control flow jumping up and down said hierarchy, but nothing too bad. I made a mental note to still refactor this, just as much as necessary to make my task easier. However... the following day, I got an email from mr. senior. "I refactored the code after all, in preparation for your task". My eyebrows raised.
Firstly, he had made the inheritance hierarchy *worse*. Classic mistake: Misusing inheritance for code reuse. More control flow jumping up and down like rabid bunnies. Pressed on that matter, he replied "it's actually not that bad". Yeah, good work! Your refactoring didn't make things worse! That's an achievement worthy of being engraved on your tombstone. And didn't he say "no refactoring"? Apparently rules are unfortunate things that happen to other people.
But secondly, he prepared classes and methods for me to implement. No kidding. Half-implemented methods with "// TODO: Feature x code goes here" and shit. Like, am I a toddler to you? Do you really think "if you don't let me do things myself I feel terribly frustrated and undervalued" is best answered with giving me LESS things to do myself? And what happened to our boss' instruction to split the task so each of us can work on his parts?
So, this was a couple of days ago. Since then, I've been sitting in my chair doing next to nothing. My brain has just... shut down. I'm reading the spec, thinking "that would require a new REST endpoint", and then nothing happens. I'm looking at the integration test stubs ("// TODO: REST call goes here") and my mind just stays blank, like a fresh unpainted canvas. I've lost all my drive.
I don't even know what to do. Should I assign the task back to him and tell him to go fuck himself? Should I write my boss I'm suddenly retarded? Could I call in sick for a year or so? I dunno... I can barely think straight. What should I do and how?5 -
Fucking sick of colleagues who just want help with fixing their own broken code, even when given different but alternative to achieve the same thing. It's even worse when they try leverage part of this alternative into their code.
When you are given a Mercedes, you drive it. You don't use it to find parts for your old broken down Nissan.3 -
Everything is shit and I have to work drive thru till 11.15pm.
Everything appears to require js at one point or another (though kotlin requires groovy which, in the intellij IDE, the template it COMES with is fucking broken from the start)
c# could work (and microsoft shop jobs are plentiful) but fucking VS code is a headache and microsoft seems intent on locking everyone into VS and making everything they touch turn to shit, like the king midas of diarrhea (thanks MS, monodevelop is source only on windows). Also c# for android (xamarin) requires apache cordova to do anything, which means...TADA, FUCKING JAVASCRIPT and all the other shit it brings with it.
Java seems like an option, lots of jobs available, but I need netbeans for desktop (javafx) and Android Studio
separately in order to do anything. And Android Studio now uses, of all things...FUCKING GROOVY.
*cocks gunfinger and points in mouth*
why must every fucking thing be it's own DSL and make everything about the fucking ceremony of configuration over
fucking convention?
Haven't any of these fucking cocksuckers heard of MAKE? Or do they just masturbate over how intelligent and smart they are for having reinvented the god damn WHEEL?
I'll see you at the drive through. Will that be all for today?9 -
So Google’s Gemini API challenge is currently ongoing and I am looking for idea suggestions.
- The goal is to create an AI enabled platform for web or mobile with Gemini API integration.
- The idea is expected to be unique or creative (unique ideas are favored so I heard)
- I found out the last winner of Google’s Dialogflow competition created a Mobile app for the elderly that provides screen flow guide on usage of some of Google’s product (ie: Youtube, Gmail, Drive etc.). This is just an idea guide and I see why such would win. It’s not a must requirement.
The final code will be open source and surely would credit the original idea owner. I need your ideas fellow devranters. What AI enabled app do you think have the best chance of winning this challenge? I have some time to spare on this one.5 -
My parents bought a C64 when I was about 8. After getting bored of Flimbo's Quest and Klax, I started looking at the manual and discovered a world of creativity.
I remember slavishly copying dozens of lines of Basic code. After what seemed like hours I was rewarded with a tiny sprite of a balloon floating across the screen.
My sister thought I was crazy; I thought it was the best thing ever.
We never had a tape or floppy drive, so I copied the same code out at least half a dozen times! -
A dev decided to overwrite the master branch with his code saying its better. That it fixes the major bugs that all of us couldn't solve.
Against my better judgement of firing him, I decided to test it.
Firing up the testing site, we made test databases to use and we went to house.
In the middle of testing, I noticed the test DBs weren't being changed. While everyone was still testing, I looked at the code. It wasn't made to test on any databases, it was specifically designed for the actual production server.
However the damage was done. In a secret dashboard in the code, someone sent instructions to drop the tables, effectively ruining the production server.
We had the dev go to an offline backup site that only went online every 10 minutes a day to make new backups. So we shut down the production server, setup a maintenance page. I get my ass chewed out again, and we were sitting ducks.
I don't think the dev had enough punishment, so I grabbed his laptop and made a full backup of his data, and locked the SSD in a safe.
I downloaded a Windows 98 and put it on a flash drive. And installed it all on his SSD. The dev is now a proud (pirate) owner of Windows 98.
He came back and started balling on his desk. We all looked at him with a pity, but he deserved it.
I'll give him the drive on Monday.
Do you think he learned his lesson?7 -
Ohh... really....
So I bricked my phone last week and had to factory restore to get it working so lost all my apps and data...
There were a few I created for myself and use but I don't do Android dev anymore (and Google decided to remove all my apps from the appstore but then again I don't care, no one uses them)
Anyway I couldn't find a good replacement on the app store.... so i pulled up the source code from my back up drive... and luckily found the compiled APKs too :)
But thought well heck might as well just publish the code but apparently... it was already published...2 -
Change is truly a difficult thing. I've been trying to introduce my group colleagues to GitHub, I even gave them some tutorials that I used. I'm not saying I know everything about Git or GitHub but the pros of using it or any VCS outweigh using Google drive, zipping and email each other the code and many other creative ways of sharing work. Let's just say two months have passed there haven’t been any change ☹2
-
I am working in the web department of a marketing company. Well, in the department there is me and my boss.
I am trying to push the idea of using git for the development of our internal tools but my boss doesn't see why it's a better way to manage our source code than using a network drive backed up with Timemachine.
What good points can I show him to try to convince him.2 -
Should I switch from windows to Linux? I'm a college student doing CS and most stuff I've seen on GitHub and such mainly have installation instructions on Linux.
I've heard a bunch of my friends go "dude if you code, consider switching to linux"
Is it worth making the switch? Should I dual boot my laptop or completely switch? Or could I make do with a bootable USB drive?9 -
For some reason, out of no where, I made this word up. It's called Moop, and it's definition is paradoxical. It means "everything and nothing, anywhere and nowhere, etc". So one day at work one of my coworkers pushed his untested commit to the master branch of our 25k project. To make matters worse, he deleted all other branches and previous versions of the project. Our project manager heard about it and became so angry that he almost broke our no-curse-word-policy. So he called is all together to get around it so he could properly vent.
Project manager: "Guys I'm extremely angry at James (the one who pushed the untested source code to our commercial project, ruining it)
Me: well, I have a word that we can use
Project manager: what is it?
Me: Moop
You can guess what the next few weeks at work was like. All of my coworkers had to fix the crap James made, including myself. So the conversations went like this: "The mooperfluffer James should have never mooped with us!", "MOOP YOU JAMES, I HOPE YOU HET MOOPED TO HELL YOU MOOPUP!!!!!", "Hey James, guess what! I hope you moop yourself". Our boss became a strong moop user and spray moop all over James workstation. We put moop in his cup, his laptop keyboard, even his thumb drive. We downloaded moop.exe to his PC so we could moop his kernel.
Today James' life is officially mooped.3 -
I have a personal opinion and correct me if I'm wrong
Why does a programmer need to learn behind the scenes stuff (memory allocation).
I know it helps to understand the concepts better.
Why would I learn how the engine of a car works in order to drive a car ?.
And the only task is required from you to drive a car.
And literally you can code without knowing any of these stuff and since companies only need clean and efficient code.
Will it be really helpful to enhance your coding skills if you know behind the scenes stuff ?6 -
I like to look back at what I considered 'programming' back in high school compared to what I'm doing now as a almost CP college graduate
Still know absolutely nothing. But that's immensely more than what I did as the best student in my high school programming elective and the barely accomplishments i achieved as a high school intern at CMU
I still have a copy of some my old high school 'code' (more like data trash)on a flash drive just for memory's sake -
I don't even know if the shitty rant gets through this unreliable service I pay for with my money. I want to fucking wrap my hand in that money, light it up and fucking beat your teeth out while shoving this fucking money down your greedy, second arseholes. Honestly, what am I paying you for. These last couple of days your service was less reliable than a drunkard behind the wheel trying to drive in a straight line. Exactly this fucking week where there's a fucking hackathon. This very fucking week l where I got to be the team leader, you make me look like a fucking unreliable internet twat who just talks big. This very fucking week I'm given a internet service that doesn't even let me communicate with my team mates. Why do you dare to display fucking 3g? Is the the force my fist should take? Is it the fucking amount of gallons of acid you want to be showered with? Well fucking pay that shit with the money you earned. Just let me fucking work, let me give my best, give me a fucking way to look at the docs, give me a fucking way to test my code (chat bot), give me a fucking way to tell you to go fuck yourself using your fucking antennas, maybe thst will help.
Kindly, a pissed of customer who's rage makes the heatwave look like a lesser evil.1 -
Hi,I want to provide a button when clicked txt file should be uploaded to cloud account.I want to do it using Java and JavaFX. UI Is easy but how to use GOOGLE DRIVE API? No complete code is given on internet.I don't know how to start from scratch.I am making a software where i need this function to link users drive account to it. Help appreciated :) .(official site of Google api is not useful)1
-
Anybody else getting annoyed with VSCode lately? I’m constantly getting updates to the editor and various plugins that add near-forced autocomplete suggestions, cursor hijacking, codelens and inlay hints (messes up spacing and layout), etc. It’s starting to drive me crazy! Just let me write my code! I love the syntax highlighting and autocomplete, but developer tools need to be optional, not have their off button buried behind some 5-layer JSON object that’s not documented anywhere!
I just want to write code, and I want my editor to be a tool, not an annoying little bee swarming my face all the time trying to get me to do things I don’t want to do! Microsoft and plugin devs need to stop enabling these obtrusive features by default and put them behind a “New Features” wizard or something!3 -
!rant
My home pc has developed a sudden issue and wont boot up anymore.
Stays stuck on the POST phase and am unable to get into BIOS , just stuck with a big asus logo and a message to press
F2 or Delete to get into BIOS but the system seems frozen as the keyboard lights are on but unresponsive while the
Mobo reads an error code A2
( the manual claims that to be an IDE error although am using only SATA)
Unplugging all usb doesnt change anything.
Unplugging all other sata ssd ,hdd and disk drives except the os drive changes nothing.
Unplugging the os drive results in the system complaining about no bootmgr
(As expected), that allows me to at least look at the BIOS but there doesnt seem to be anything wrong or out of the ordinary..
Booting from a live cd works fine
Booted from a pc boot repair tool and plugged in the os drive into one of the hot swappable sata ports shows me the all the files still there and accessible , check disk revealed nothing wrong. Can't plug in the os drive pre boot as that locks everything up again)
Tried to boot with a windows cd then do a start up repair but plugging in the os drive into the hot swappable sata doesn't work since windows can't see the drive.
Tried to swap the os drive with another one of exact same model filled witb random files resulted in no boot mgr error as expected
Struggled a whole weekend to fix it but alas no progress
Ah and the OS drive's warranty ran out 2 weeks ago 😑
Mobo asus p9x79 deluxe
Os ssd samsung 840 250 gb
No changes in hardware for the last year
Or so
No BIOS changes in over a year
I did notice some odd files like 0002Found
On the os drive when i was using the boot repair live cd tool, will bring the drive to
The office where i can get my hands on an ssd sata to usb caddy and take a snapshot of The files there for you guys to see.
Any ideas ? 😞5 -
The VCS I love is Git with GitLab.
The way client code reviews is via email pointing outline number for explanation and expects to send the zip file of the entire project via Google Drive.
why the fuck git exists?? -
The timelines at my workplace are too short that it's impossible to actually build anything or observe procedures like testing, software techniques for maintaining oop code, telemetry and other things I may have learnt along the way
So application templates are the order of the day. They pull solutions off the shelf, edit the interface, hand over to clients at an alarming rate (sometimes, within a matter of days!). So yesterday, the cto asked for ways I can recommend that the team is made more efficient. He takes what I say very seriously, owing to Suphle's appendix chapter as well as the issues its blueprint set out to solve
Like I said, those do not apply here. I mean, the developers I've met are making do and winging it. I'm the one struggling to adapt to rummaging through templates and customise shit
Maybe I'm over thinking it cuz there's no sense in fixing something that's not broken. So far, only flaw I've observed (because the product designer has complained to me bitterly that the devs hardly ever translates his prototypes verbatim), is the need for a dedicated mobile developer (not that multifunctional, confused portfolio called "fullstack). But I didn't raise this since the time frames hardly even afford time for writing apis or writing mobile code. You'd be surprised to realise that everything a client can possibly ask for is already somewhere, built at a higher standard than you can replicate
My question now is, what other positive novelty can I bring aboard? How can this process be further optimised? If it can't, what suggestions outside regular software development or this work flow can I bring to the table?
Personally, I'm considering asking him to tell me bottlenecks if he has identified any. But it's very likely that he would already have begun working towards it if he knew them. I suspect he needs someone outside the system to see what is lacking or a new addition that could even be a distant, outlandish branch of the tech market, but drive the company towards more profit1