Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "dont think just do"
-
Me - "Has anyone changed the password on the print computer"
Him - "It's the same one."
Me - "Carrots99?"
Him - "Yeah, what's the message that comes up?
Me - "Password is incorrect."
The dumbest conversation I've ever had in my fucking life. You little shit, I know you changed the password just to fuck with people. You've been reading too many books on elevating yourself, tried to be important for something. It means fuck all if you can't remember what you changed it to. So you held up two hours of my work, not to mention everyone else, because you can't help but stick your beak in shit. You dont think people can't see what youre doing? Watching you scurry over to the computer with a big smile, only a to fuck off silent as a mouse not to be seen mumbling some shit about a system administrator. Yeah you forgot it you prick.
Stop sucking up to the boss, and commanding people on what to do, when you're as junior as junior gets. Don't change our fucking passwords, just so you can have the whole team approach you the next day asking for you, then not remember them. You cunt.8 -
Went to go help someone with their wireless printer.
Client: my printer doesnt work.
Me: okay let me take a look at it.. (took a look at it and saw the power core wasnt plug in)
So it seem like you forgot to plug in the powercord. Do you by any chance have it with you?
Client: well it said it was a wireless printer so i didnt think i would need it. I threw it away.
Me: well yeah wireless as in you dont need a usb core to connect it to your computer you can just do it through wifi.. but it needs a power source in order to turn on..
Client: well then why did it said that its a wireless printer if it needs a cord? Thats false advertisement.
Me: Sir the printer is a wireless printer but you cant get power wireless you need a power source in order to turn on the printer.
Client: you probably dont know what youre doing.
Me: *its okay hes only 79 years old*8 -
*meeting with boss about a quick site for one of her clients*
Boss- "okay so basically I just want you to copy the content from -already made site- and put it on the new one"
Me- "okay sure do you want it verbatim or "
Boss-"no but something similar"
Me-"okay so you want me to paraphrase this list that's on the homepage?"
Boss-"Well no we dont actually need the list at all as it isnt relevant to us so just take that out"
Me-"okay well that is the only thing on the homepage so what should I replace it with"
Boss-"I dont know, something similar to the list. You can figure something out"
Me-"....I dont know anything about the clients business. I am not going to just make up content, you guys can at least give me some direction there"
Boss-"i didnt think it would be that hard"
Me-"it's really not hard. You're making it harder than it needs to be for me though. Anyway, do you wanna keep the same exact pages as the other site or only transfer some of them or"
Boss-"something that resembles that website but isnt exactly it so some of the pages but not all"
Me-"which ones"
Boss-"the ones relevant to client's business"
Me-*closes notebook, stands up, starts to leave room*
Boss-"where are you going"
Me-"I'm going to get another two cups of coffee cause I didnt have enough this morning for this bullshit"
Boss-*raises eyebrow*
Me-"dont tell me to copy paste a website at first and then continue to tell me its going to be "similar" but different and then further continue to be as vague as possible about what is expected of me to be done in order to make it different! Take the time to decide what it is you want exactly and then tell me, with detail, what you're criteria is so I can do the thing!! I cant read your mind."
Boss-"..... I just didnt think it would be that hard to jot in a few sentences here and there"
I left the room at that point. Irritating as fuck. You dont know tech stuff, don't expect me to know enough about YOUR job to write about it as if I'm a professional. I cant fucking read minds, I have no interest in researching anything just to create the site content myself, and its fucking rude that they wont even take the time to sit down and decide what they want for a website that THEY are paying for. For fucks sake people get your fucking shit together13 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Get ready for one of the biggest AMAZON rants EVER.
I dislike this company so much I can feel it in my bones.
They have NO, absolutely NO idea how user experience works.
PROBLEM #1.
If you have Amazon Prime / Video (ANOTHER FUCKED UP PROBLEM THAT CONFUSES A LOT OF PEOPLE) and you want to watch a movie on your Xbox using the Amazon App, You have to buy the movie ON YOUR COMPUTER FIRST, YOU CAN’T BUY IT DIRECTLY FROM THE APP.
WHAT THE SHIT AMAZON?
So.. go to your laptop, buy the movie, go back to your other device (Xbox or whatever), click “My movie library” and then you can watch it.
OH AND THERE’S ALSO A “MY WATCHLIST”, WHERE YOUR NEW PURCHASED / RENTED MOVIE DOES NOT SHOW UP.
Yes.. there is a “MY WATCHLIST” and “My movie library” or some shit.
HOW, WHY, WHY FUCKING AMAZON, WHY.
PROBLEM #2.
“WE HAVE A ZILLION ALEXA SKILLS NOW !!!1!!!!!11111! EINZ!!!!!”
Yeah, WELL, NOT THAT HARD WHEN YOU HAVE “Alexa Evangelist” traveling to every DAMN tech convention and having them make USELESS FUCKING SKILLS THAT NOBODY WANTS USING BOILER PLATE CRAP THAT ANYBODY CAN USE.
Oh and Alexa is DUMB AS SHIT.
I asked her "Play the song Starboy by the Weeknd" and she said: "I CAN'T FIND THAT SONG"
Then you go "Play me Starboy" and she goes: "HERE IS A SAMPLE OF STARBOY BY THE WEEKND"
Same with other songs: "YOU DONT HAVE IT IN YOUR PRIME MUSIC LIBRARY".
She doesn't even TRY to go to your fucking Spotify account, you have say: "Play Starboy by The Weeknd on Spotify" AND THEN she still has the FUCKING NERVES to say : "I Can't find that song on Spotify".
BUT YOU JUST FOUND IT ON YOUR OWN DAMN CRAPPY PRIME MUSIC.
"Hey Alexa, how many days till the end of the year?"
GUESS WHAT ,SHE CAN'T TELL YOU. (maybe now but not 2 months ago)
PROBLEM #3.
AUDIBLE.COM and AUDIBLE.CO.UK have DIFFERENT FUCKING DATABASES, THUS, YOU CAN END UP HAVING 2 ACCOUNTS AND HAVING 2 LIBRARIES, and.. THERE IS NO WAY TO FUSE THEM INTO 1 account.
OH MY GOD, HOW IS THAT EVEN POSSIBLE?
I FUCKING HATE that, how can ANYBODY think that is a GOOD IDEA?
PROBLEM #4.
Their website is a TOTAL FUCKING mess, really, who the FUCK designs that piece of SHIT.
Look up a movie, let’s say “SCHOOL OF ROCK”
First result?
“School Of Rock” - “Amazon Video”
So you can click on this and watch the movie.
Then click the second result.
“School of Rock Blu RAY” and next to the price-tag “PRIME”
You click on it, you can buy it, but HEY, LOOK, WHAT DOES IT SAY?
“Unlimited Streaming with Amazon Prime
Start your 30-day free trial to stream thousands of movies & TV shows included with Prime. Start your free trial”
WHAT, WHAT!!!! CAN I WATCH THIS WITH AMAZON PRIME? OR DO I NEED THE AMAZON VIDEO? I DON’T GET IT.
Put me in a room with all those FUCKWIT project managers and their fucked up company culture and I’ll rip them a new one, I can go on for DAYS about the SHIT they are doing.15 -
Dear Indian Companies,
Why do you hire for a role and then say: "We dont have that role but then we want you to grow up to be a Generalist"!
6 years as a build, release and SCM guy at Moto and Nokia back then, I shifted to this big Indian IT corp coz Nokia was shutting down...
A week into my orientation (which is a crazy weirdness inducing ritual in and of itself), the new manager I'm supposed to be working with comes up and says- "Here's the code repo, there are 2 open jQuery issues, fix them!"
I'm not really sure what to say at this point because jQuery is nice and all but thats not who I am.. I'm the infra / DevOps guy. And this is circa 2012 when DevOps as a term was just hotting up...
Tell me to setup a multi-stage pipeline and automated test cycles, I'll do it drunk, but oh no! bug fixing on a jQuery script? Noooo!!!!! I just dont have the chops for it.
So long story short, I get reported to HR for insubordination - Yeah, Go Figure!
Cue: HR meeting
HR: You wont work?
Me: I cant work on jQuery. I am a sysadmin / devops guy... Give me a project that involves those skills and I'll work.
HR: But we hired you to work on jQuery.
Me: But you did not mention jQuery / UI / UX in the job description - Pulls up email and shows JD for interview which says Symbian, Build, Release, Configuration Management but NOT jQuery.
HR: ....
Me: :-/
HR: But we want you to be a generalist.
Me: #wtf
HR: We want an engineer to be able to do anything he is tasked with!
Me: Can I know my last working date here?
And thats how my career at a glorious IT corporation just went poof!
When I think back on it, I feel good that I chose to do what I wanted to get better at and what I loved working on...
And this is the problem with IT companies in our country - They play with people's aspirations and passions... To the point that all thats left of a software engineer is the looking forward to pay day so he can start the damn cycle all over again.11 -
I was once working for a company as a part time dev in the centrum of my city.
After working there for almost 1 year I noticed that I didn't get paid the last 2 months. I think it was about 500 euro's. (1 day per week).
So I went on my bike to the company to see whatsup. I came into the store and told my boss I hadn't been paid for 2 months. Even tho I did work.
He then got so angry! Just started yelling "YEAH BECAUSE THE PROJECT ISNT NEAR COMPLETE, NOTHING IS WORKING" I explained him the panel still had to be configured and that everything he asked me to do had been programmed and he then fucking told me he wanted it a different way even tho we clearly discussed it WEEKS AGO and he clearly said what he wanted. so he wanted dont revisions. I told him that this is not possible at this moment because holidays are around the corner and I want to go om vacation. (and he too!!!)
He then got so fucking angry he said "come with me for a second" we walk to the door of the building and then he just pushed me out of there and kicked me in my back.
I got so fucking pissed, I opened the door and asked him if je thinks this is a normal way to discuss. He closed the store door again, and I couldnt hold back anymore. I threw my full can of Red Bull against the glass door. The can exploded, and his whole fucking window had energy drink on it. He took some fucking steal pipe, so I walked back. But while trying to get away I jumped on his store sign. Which broke into pieces (they are quite expanasive). He came outside with his fucking pipe and he was trying to hit me. We had a crowd and people started yelling at him. I walked away but the asshole took my bike and put it inside his store. So that I couldnt leave.
So than I called the cops and reported him. For minor assault and some other things. Shortly after I deleted the entire project from his stupid server.
I really dont know this kinda shit happends, he probably felt like I didn't deserve that money even tho I did everything he asked for within deadline. Trying to solve it after vacation was also not an option. I signed him up for a few news letters after that.10 -
I really fucking hate when people or companies do shit like this..
Apparently Google is changing the salad emoji, which is a bowl that contains lettuce, tomato, egg, onion and stuff like that, to the same, but without the egg.
Why you may ask?
Well.. they did it to "make it a more inclusive vegan salad".
ITS JUST SOME WHITE PIXELS FOR FUCKS SAKE. How would any vegan, besides the crazy ones, be upset about a moist egg in their crisp salad?
I cant even.. im out of words.. fuck.
Additionally, the news page i read it on have been so kind to host a poll of what people think about it, whether its a good idea or not.
Ill let the image speak for itself, if you really need a translation, dont use google translate, ask in the comments.
42 -
Woohoo! 32k achieved!!! Finally I can post some new rant without risking some sudden overshoot 😁
So putting celebrations aside for a minute, a while ago I've noticed a tingle when I stroke my finger across metal areas of my tablet, or the sides of my phone (which probably has metal near it too) while it's charging. And it's been bugging me ever since.
Now, some things to note are that it only happens when my feet are touching the ground though slippers, and that the frequency is so low that I can actually feel the tingle when I slide my finger across the material. This to me at least seems like electricity flows through me into ground, and touching the ground directly provides a path so easy for the electrons to run away that I don't feel it at all. But if I lift my feet off the ground entirely, I just get charged up and after that, nothing else happens.
So those are my ideas. The answers on the subject on the other hand.. absolute cancer. Unsurprisingly, most of them came from Apple users. Here's some of them.
https://discussions.apple.com/threa...
- I've not noticed it, but if you're concerned bring the phone to Apple for evaluation.
- Me too facing same problem.. did u visit apple care?
And one good answer at least...
- google emf sensitivity, its real. You are right, there is a small current flowing through your body, try to limit your usage. The problem with this issue is those who aren't affected (lucky ones for now) will tell you these products are 100% safe. To a degree they are, i used my ipod touch for about 2 years straight vwith virtually no symptoms. then the tingling started and it gets worse.You will get more sensitive to progressively less powerful things. I dont want to scare you but just limit your usage like i didnt do 🙂
Overall that discussion was pretty good actually, aside from "bring it to the Genius Bar, they'll know for sure and not just sell you another unit". But then there's Reddit.
https://reddit.com/r/iphone/...
- Ok, real reason is probably that the extension cord and/or outlet is probably not grounded correctly. Either that or you are using a cheap knockoff charger.
Either use a surge protector and/or use the authentic Apple Charger.
- It's not the volts that hurt you, it's the amps
- I think you are in deep love with your phone. That tingling sensation is usually referred to as "love" in human language.
- Do less acid, I would advise.
Okay, so that's the real cancer. Grounding issue sounds reasonable despite it being wrong. Grounding is actually not needed when your charging appliance doesn't have any exposed metal parts. And isolation from high voltage to low voltage side actually happens through things like routering holes into the PCB, creating spark gaps, and using galvanic isolation through things like optocouplers. As for a surge protector? I'm using them to protect my PC and my servers, but the only purpose they serve is to protect from.. you guessed it.. voltage surges, like lightning bolts hitting the grid. They don't do shit for grounding or reducing this tingle! What a fucking tool.
It's not the volts that kill, it's the amps.. yeah I'm sure that the debunking of that is easy to find. Not gonna explain that here. And the rest of it.. yeah it's just fucking cancer.
Now what's the real issue with this tingle? It's actually a Class-Y rated (i.e. kV rated) capacitor that's on the transformer of any switch-mode power supply, including phone chargers. If memory serves me right, it helps with decoupling the switching noise and so on. But as it's connected to the primary side of the transformer, if the cap is sufficiently large and you are sufficiently sensitive, it can actually cause that tingle by passing a fraction of the mains electricity into your body. It's totally safe though, as the power that these caps pass is very small. But to some, it's noticeable.
Hope you found this interesting! And thanks a lot for bringing me to 2^15. I really appreciate it ♥️
14 -
My college organised some interview with a company, with the whole demn class. We went there, it was quite far away (50km) and the CEO invites us to a meeting room.
Where he bores me for 2 hours talking about their projects in argiculture and NSA like spying systems at tankstations.
They were caputuring license plates at gas stations and with that information gather data about the person, such as salary (by looking at their car), house adres ect. All without people knowing. And than targeting them with specific ads and offers.
The class of sheep were super excited but it pissed me off. Because he told it like it was some awesome advancement in technology that none of us could probably ever do.
He was demeaning us, saying we would do some simple wordpress sites there and other things. We are probably not good enough forc te big stuff.
Asking him some really hard questions about his projects made him so pissed he almost wanted to kick me out.
When it was finally over, there was some test that you have to do if you want to work there. If you were good enough at the test, you could!!!! (YEEY)
Uhm, I said; no thank you I dont want to work here.
Later I talked to my classmate and friend who always thinks he's better then everyone in class even tho he barely understands OOP programming. He was asking me if he should try to get the internship. I told him; dont. They have no value for us and they think they are the greatest company on the planet.
The fucking idiot go so pissed, he stopped talking to me alltogether and blocked me everywere. I AM NOT EVEN JOKING. Just because I gave my FUCKING opinon about a company he likes for no reason.
So this idiot does the test (which was fucking simple btw, I did it too and compared the results and I had 95%) He gets invited for another interview and gets told he will be paid 200 euro's per month 😂. and a free meal everyday!! 😪 hahaha . That doesnt even cover commuting costs!
My "friend" told him that the train costs more every day. You know what the CEO said? "Yeah but you can learn so much here the also brings value and you're just a last year student. But I think you are really brave for asking more"
So in the end, he couldnt take the internship and I was fucking right. Really I hate these kinds of companies thinking they are heaven on earth when they are clearly not.
I am happy I told them no before putting my dignity on thd line.14 -
So I ve been clinically depressed for about 10 years now. Been really great at hiding it. My illness and loneliness was so severe that i made up imaginary friends and that got so severe i couldn't tell what s real and what s not. Then about 5 years ago, i met a girl. As the cliche goes, everything felt better. Sunshine and stuff. I opened up to her. Shared stuff. I started becoming normal. The pain became bearable and manageable. Turned to entrepreneurship. Had goals and stuff. Had 7 failed startups but kept on going. Raised investment for an 8th. It went better than anyother. Was going to become the next big thing bla bla. She became the reason i turned from being a loner weirdo to someone awesome. Anyway, as nothing tends to last, my best friend who had been through thick and thin in my work, quit last year in October. He messed up some work from big client nd we had a fight. He left. In the meantime i scored a big multinational company. I was gonna propose to my girlfriend in March this year. But instead she decided to leave for someone better who left her in 3 weeks lol. Anyways, we broke up. During that time, my second friend decided to fuck up my work with the big company so hard that they were about to blacklist my company. And then he left too. I had a small team. 4 5 people doing their best. By that time, i was the only one left. On 28th feb i had my breakup, on 1st march i was sitting 700 km away from home in an office trying to talk the company out of blacklisting us. It took me around 20 days to make that happen. All the while dealing with the obvious, my depression getting stronger than ever. My imaginations taking shape and fucking up my reality. The voices in my head getting stronget and stronger. 4 months now since she left. I dont think i miss her anymore. She tried coming back once but i didn't let her. In the 4 months, i m at my worst. I am getting government contracts now. But i have no desire to do anything. The pain is unbearable. So much that on its good days it sucks the life right out of me. So much that when it gets severe the urge to harm myself in any way goes of the charts. My best friend and i, we became friends again after my ex left. He s been helping me as much as he can. I have all the good oppurtunities and chances that any entrepreneur who has been busting his ass for 5 years straight would kill to have. But i cant do anything. I m the only one left on my team. I have to handle the business, dev, marketing etc etc ends on my own. I tried hiring and scaling up but i messed that up because of obvious reasons. And now my company has 2 months of runway left. And i know if i bust my ass i can make it to 8 months more and even raise a round a. But its really hard to do when either you re sleeping 20 hrs a day or you re sleeping 3 4 hrs because you re afraid of the nightmares. Or when even you ve had a good day, the pain becomes so much that you lay on the floor having a breakdown. Yeah, i m trying professional help. I m hoping it helps me. Because right now, i dont care about being happy. I just want my sanity. Something i m clinging to with every fiber of my being. Something that s burning out like a candle burning from both ends. I cant give up my work. I dont want to. That s all i have. That s all what i love doing and now i cant even do that. I just want this to end somehow. Either i get better and the pain and the void and silence and everything else goes away, or i do. I dont know what will happen first. And i dont care. I just want to be normal. But i guess that s too much to ask.8
-
OK.
1. So i tindered.
2. I got a really nice girl.
3. We chatted really long and good.
4. We tried to meetup it did not work because of our schedule. New
job on my end, she is a student.
5. I thought its over. Fine whatever.
6. She gives me her number.
7. We continue chat on whatsapp
8. Blablabla 3 days long, she gets bored and tries to friendzone me
9. I revert the shit and state i wanna be serious and there wont be a
friendzone/nice guy comin from me.
10. She happy and continues to chat.
11. I get emtionally invested in her.
12. We exchange thoughts dreams and music.
13 We want to meetup at weekend. I cant. Got a family wedding all
weekend.
14. We want to meetup the second week.
I cant. Im off on a company trip. Again new job here.
15. So we say in the week after I get back.
15a. Before the weekend we need to deliver an rc and go all out to hold
the deadline.
15b. We deliver, but shit happens on the customer side. His fault but we
get the blame.
15c I go onto the company trip.
16. We chat and i send her pictures of the trip over the weekend so she
sees I care.
17. She seems fine. And happy.
18. I come back from the trip late night and need to work the next day
jetlag style.
19. I work jetlag style. And try to fix the shit from last week.
20. I come home really tired and looking forward to date day tomorrow.
21. I cant do anything. My home looks like shit and the bag still
unpacked. I just eat and fall asleep.
I feel bad bcs my home will turn her down instantly if we make it to my
place.
Need to hope that it does not come to this.
22. Date day comes. Today.
23. I wake up at 6 early to plan ahead to make sure my clothes are fine
and i arrive on time in the office to exit early.
24. I expect to check what goes on today in the city and give her the
location to meet and time.
25. I enter office and immeadetly get caught up in meeting planning, dev
questions and the meeting itself because the project is on edge.
26. We have a 5hours long meeting where people go on and on and on.
27. 3h later in the meeting:
my brain was fried and around 12 i go to lunch with some people.
28. Meanwhile the city is turning into a rainy mess of a shitty day. No
way I can have a nice walk with her like that. Bars and coffeshops are
just to boring.
29. So i eat to regain some sense and we go back to the office.
Meanwhile I am thinking all kinds of locations and stuff in my head.
30. Havent given her any update since a good morning in the morning.
31. We reenter the meeting. Things continue like before. The project is
on impossible demands and impossible timelines. Still we try to do our
best.
32 3h later on 3pm I tell her i am in a long meeting and working on a
meetingspot.
33. shes not happy.
34. I get a call from a relative
35. i need to go out and take the call. not good for the collegues.
again new job here.
36. family trouble, money trouble, goverment demands. I promise to
handle that tomorrow. Before work.
37. i get back into the meeting.
38. still super slow and no results.
39. need to focus but start to check for locations on my phone.
40. she asks me where i am
41. I send her my location.
42. she thinks i am saying she should pick me up!
43 i joke and say no definitly not.
44. shes pissed.
45. I decide for a coffeeshop. after work. and send her the location
46. She says to call it off.
47. I go all in and go romance style. I say ill wait there even if she
does not come to show her how much i care.
U know to avoid the lets do it some other time fuckery and then it never
happens.
47. She goes quiet.
48. 2h later we finish the meeting. Meanwhile QA foudn a bug we need to
fix because why not.
49. I got 30 minutes to find the bug and fix it before I need to go to
uphold my word.
50. I find out what to do, but it might break a lot of other things
without careful test and implementation. Collegues says he takes it.
51 I feel bad but I need to go. I even leave earlier because otherwise I
would not be on time.
52. I arrive 15 minutes early. I grab two coffee2go and wait outside,
53. Shitty weather, sometimes rain, sometimes sunny, cant decide what it
wants.
54. The weather is just like how I feel.
55. I wait 1 1/2h
56. I think I should feel stupid, For gods sake its tinder. People dont
give a crap, Enough people around why should I Invest so much into this?
But I dont feel stupid. Because this is how I want it. I dont want
appointments, I dont want safety. I decided for her and I went all in.
57. I send her pics from the sceneray as proof that I waited,
58. I think I blew it. She is still quiet.
59. Friends are asking me for plans for the weekend. I wish I could say
I already have some with her.
60. I feel lost right now. But my head says I put too much stress on
her, And i fucked up with the planning. I should have been more precise.
My head also says that i am putting myself into the victim role, which
is wrong always. Should I continue to reach out to her? Is there
something I could do still?68 -
The state of the web in 2020:
discussion sites as a medium are dying. chalk that up to censorship.
reddit is an echochamber. twitter is mostly a marketing platform disguised as (anti)social media. instagram is a self promotion/wannabe eceleb site, and youtube is the new hollywood..quickly becoming irrelevant.
facebook is where I (dont) go to (totally not) ignore all the people important to me.
and email is where I go to send letters bordering on hatespeech to my various local and federal "representatives", in between borderline cyberbullying people stupid enough not to automate their spam marketing in 2020. or talking to left/right self-help grifters about the state of society.
in the grim dark future of 2020, the last bastion of intelligent conversation, free speech, and civility, the one shining icon of hope in a dark world..
is the comment section of pornhub videos where a women got stuck under a bed for the 50,000th time. And all I can think is "wow I never knew how easy it was to get trapped under a bed. They should look into fixing this safety hazard."
newsmedia has jumped so many sharks, the fonz now spins in his grave so fast we could hook him up to a generator. meanwhile people hide in their homes for a disease so deadly you have to be tested to know if you even have it.
while ever more car commercials
are released, set to somber but hopeful piano music to the tune of "in this time of social distancing its important to stay close even when we're apart."
Im beginning to think media has become a poison on society, both television and the internet, and like an ersatz cargo cultist worshipping the great-charles- manson-in-the-sky we should all take a page from the unabomber and smash our televisions with hammers before going outside and sawing down the telephone polls.
I jest of course. But there is no denying the inherent appeal of moving from the unsettling uncertainty of complex societies, driven by expertly manipulated fear cycles, to the beatitude-esque simplicty of pastoral protestant style living, sans witch burning and shoe buckles.
And against the reckoning of utopians who are still fresh from the womb as it were, wet behind the ears and smelling of their mother's pussy, I reject the notion that "up" is a synonym for "forward."
Were it the case, every drinking binge, followed by throwing up, would bring us, with each vomitting, one step closer to heaven. Rather the state of affairs is what it is, and what it is, like most of nature, is a cruel master and a harsh teacher. And while we may binge on digital delusions of grandeur and a greater society, rest easy in the nihilistic and sobering thought that we are little more than 200,000 year old cave men wielding magic bricks, and atomic bombs.
..where water flows more readily from metal tubes in our houses than it does from the nile. where food comes to our door at little more than our beck and call.
where we may bath, and sleep, and *shit*, cleanly, comfortably, and safely, wrapped in the (failing) bubble of delusion we all tenaciously grasp collectively, the thing we call "civilization".
an empire of needful things, wanton and fragile.
if we have not gone mad from boredom, I have no doubt we one day will.
it becomes more and more obvious to me every day, had war never existed, it would have been necessary for man to invent it just to have something to do, that didnt include farming, fucking, or building.
And so enters "political idealogy."
How would we ever have enemies if we were allowed to speak our piece instead of being given the means (and reflex dogwhistle training) to silence and destroy one another?
give a man a gun, he'll rob a bank. give a man a bank, he'll rob the world.
give him a media empire or a tech platform, and he'll lie about the theft and convince one half of millions of lemmings to hate all the other lemmings.9 -
Is there a lot of people in the same boat as me?
I'm a self taught guy. Never in my life had I a senior developer i could bug for answers. Every little bug and inconveniece i have ever experienced - left alone to cope and find solutions. I just feel like sooo burned out. I have some large complex system questions building up and googling doesnt give me the answers anymore. This is frustrating. I'm supposed to be a mid level developer, but I'm acting as a senior to one of my colleagues even though I have so many questions and doubts in my mind. I think I developed a lot of plot holes in my knowledge and I have no real way to know which are which. I feel I dont know so much. Fuck. Where do I go from here?15 -
In january 2023 i was contacted by a recruiter offering me a job position.
I DID NOT ASK FOR A JOB.
I WAS NOT LOOKING FOR A JOB.
THEY contacted ME.
Ok. So i went along with it and see how it goes. They probably wont hire me nor would i give a shit. Chatted with this recruiter for a while. She forgets to answer my message for 5 fucking days. Twice. Once because she was doing God knows what and the second time because she was on paid vacation. Fine i don't give a shit about you at all anyways.
So this recruiter chatting has been stretched out for several days. I think over a WEEK. So she forwarded me to their lead developer.
I applied to work as a full stack java spring boot backend + angular frontend engineer.
So:
- java backend
- angular frontend
- full stack
- shitload of devops
- shitload of projects i built
- worked with clients
- have CS degree, graduated
- worked a job at their rival company
What could go fucking wrong with all of these stats right?
During technical + hr interview (3 of us on google meets) they asked me what salary I'd be comfortable with.
I said $1500/month straight out.
keep in mind:
- In my country $500 or $600 is a salary for engineers per month
- You get a raise of +$150 which is around $750 after working for 1+ year
- You can earn $1000+ after you work for +2 years
- Rent here is $200-300 a month at minimun. And because of inflation its just getting worse especially with food. So this salary is not for living but for survival.
Their lead engineer gave me a WHOLE ASS FUCKING PROJECT TO BUILD and i had to code it within 10 days. Great so at least 17+ days of my fucking life to waste on these fucktards who contacted ME.
The project was about building a web app coffee shop literally what mcdonalds has when you order via those tablets. I had to build this in java spring boot and angular. I had to integrate:
- docker, devops
- barmen, baristas, orders
- people can order at the table or to go
- each barista can take 5 orders at a time
- each coffee has different types of fields and brewing time
- each barman brews each coffee different period of time
- barista cant take more than 5 orders for to go until barman finishes the previous order
- barista can take more than 5 orders but if those orders were ordered from table, and they have to be put in queue
- had to build CRUD admin functionality coffee's
- had to export them all of the postman routes
- had to design a scalable database infrastructure for all of this alone
- shitload of stuff more
And guess what. After 10 painful days I BUILT THE WHOLE THING MYSELF AND I BUILT EVERYTHING THEY ASKED FOR. IT WAS WORKING.
Submitted it. They told me they'll contact me within 7 days to schedule the final Technical interview after they review what i built. Great so another 17+7 days of my fucking time wasted.
OH and they also told me to send them THE WHOLE GITHUB REPOSITORY AND TRANSFER OWNERSHIP TO THEIR COMPANY'S OWNERSHIP. once you do this you cant have your repository back. WTF? WHY CANT YOU JUST REVIEW THE CODE FROM MY PUBLIC REPOSITORY? That was so weird but what can i fucking do argue with these dickheads?
After a week of them not answering i contacted them via email. They forgot and apologized. Smh. Then they scheduled an interview within 3 days. Great more of my time wasted.
During interview i was on a google meets with their lead engineer, 1 backend java spring boot engineer and 1 angular frontend developer. They were milking me dry for 1 whole fucking hour.
They only pointed out the flaws in what i built, which are miniscule and have not once congratulated me on the rest of the good parts. I explained them i had to rush those parts so the code may not be perfect. I had other shit to do in my life and not work for your shitty project for $0/hour for 10 days you fucking dickriders.
So they quickly ran over to theory. They asked me where is jwt token stored. Who generates it. How the backend knows to authenticate user by it. I explained.
What are solid principles. I said i cant explain what is it but i understand how it works, why its needed and how to implement it (they can clearly see in the project i just build that i applied SOLID principles everywhere) - but i do admit i dont know the theory behind it 100% clearly.
Then they asked me about observables and promises in angular. I explained them how they work and how subscribe method is used (as they can clearly see that i used it in the code). Then they asked me to explain them under the hood of how observables work. The fuck? I dont know and dont care? But i can learn it as i work there?
Etc
Final result: after dragging this for 1 fucking month for miserable $1500/month they told me: we can either hire you now but for a much lower salary which you probably wont be happy with, or you can study more these things we discussed "and know why the car leaks oil" and reapply back to us in 2-3 months!23 -
Dear wordpress developers,
You have my sincerest apologies. I used to think developing with wordpress is what people do when they are feeling lazy and dont want to work with code and frameworks. But no... wordpress,shopify and all those shitty ready CMSs are by far the worst methods of developing websites or web applications. I have spent countless hours in my new job in the past two months simply trying to resolve issues caused by wordpress websites suddenly deciding to stop working after one of the billion plugins required to do the simplest of tasks was updated. The money i need to spend on premium plugins alone makes developing the website no longer profitable in the first place. And god forbid the client asks for a very simple frontend edit that the theme doesnt offer in the theme options menu. Even tho doing the feature from scratch would take next to no time at all if you do it yourself... you end up trying out a hundred plugins just to achieve something in a ways that feels very forced. Nothing will ever top cakephp for me2 -
Had a LinkedIn recruiter contact me a few months ago, I usually get one of these a week at minimum and usually more frequent the moment a start a new position. I hate that!
Anyway, story and rant:
The recruiter sent me a position that was pretty good, lots of benefits, not too far to drive, some remote days. With the usual list of responsibilities that they themselves dont know what half of them are but put them on anyway, I would automate those anyway if I wanted to work there.
All looks great, I ask if they can send me more details and the budget they company has for the position.
This was for a Senior position so I thought they would know what industry standard is.
The recruiter replies with a budget: $2000
I actually couldn't believe that they thought that was acceptable amount of money for the amount of responsibilities they wanted this new senior guy to do, no wonder the previous guy left.
I respond and told her that the amount is extremely low for what they want and I dont think they will find someone with the skills they need at that amount. I would be willing to talk for a minimum of $4000 and thats not guaranteed until I can go for a formal interview to find out exactly what the company needs.
The recruiters replay was probably the rudest anyone has ever been to me online, lol! She insists its industry standards and any Senior would be lucky to get such a great paycheck, the company has been in business for years and their developers have always been happy and paid industry standards.
I respond again and tell her that im getting $3800 at this small company where I currently am and if the "international company with clients all over the world" wants to have my skill set why is it that they cant pay premium salaries!? As well as the graphs for my Country on what the current industry standards are for salaries in my industry.
She never replied, but I kept tabs on the company she was recruiting for. They are still looking for a senior dev, its been 8 months now and no one has applied.
I am so happy more developers are standing up for themselves and not taking agencies bullshit with low salaries, crazy overtime and bad technical specs.
Note: Amounts are made up, was just to show comparison.4 -
Im so frustrated with myself . I've always been afraid of being stupid . Perhaps it was because i was always called the "less intelligent" sibling by my parents . Well i did self-learn java , c++ and android (when i was 15) and made some apps and i did get acknowledged finally but i may have not acknowledged myself . I got into college a couple years ago and i can tell you right out that its like an island filled with stupidity. The teachers , the students. The other day i caught my teacher learning how a transistor works. This is unacceptable for someone who is teaching us advanced op-amps and other circuits . Well , I did get into this college cause it was less tedious and i thought college doesn't matter cause i can self-learn . All i needed was free time . Well college totally destroyed that too and provided no facilities in the process as well . So yeah should i blame my college for my inability to do things the past couple years. I mean i don't think i've learnt a single thing all this while. This is where my frustration begins cause i dont want to blame the college , it's not going to help me and i'll probably end up in a 9 to 5 call center job at this rate . Im also very heavily frustrated with myself , it's like everything i've done so far has been a path of least effort. I have tried a few things which were all just fads like machine learning and crypto and even trading . They felt good and thats what scares me , maybe i don't have the passion and am just looking for a quick buck . This is clearly reflected in the ideas i've been having as well . Well i've never had access to proper funds but now im just trying to justify this layman emotion . I just want to learn and be passionate about learning , researching and i just want enough funds for that . But im afraid , maybe its just that i want to feel superior than my circle . I mean i still don't know why i tried learning rust and wasted even more time setting up fedora and everything around it while i already had a working debian setup and a programming language i'm kind of versed with . i wouldn't say well cause im a self learner and i feel guilty for that . I definitely know i just learnt the surface of the language . Deep down i'm just another stupid fad obsessed guy who feels better by choosing a more complex language that my colleagues look upto . Is this what i am , if so im scared and i don't know what to do . People say that you are what you are and you cant change that . If i cant change this then i dont deserve this wasteful stupid life . I don't know what i should do and it makes me cry . Maybe acknowledging this would've helped but it hasn't , I've felt better playing fortnite rather than learning some basic electronics. Im another one of those aren't I ?17
-
DO NOT be afraid to argue with people. It doesnt matter who they are. Senior engineers, tech leads, delivery managers, if you know something is wrong make it heard. I made a point of telling my Project Manager that the current project is the worst ive ever seen. The technology is awful and we all hate the development. They need to know this stuff. And if they come to you with a deadline that you dont think you can make, say it then and there. Then they cant come back and say why isnt this done. Basically dont just do as youre told. If we needed that we would get robots to do our job. We need people who think and have opinions and make those opinions heard at the appropriate level.2
-
TL; DR: Bringing up quantum computing is going to be the next catchall for everything and I'm already fucking sick of it.
Actual convo i had:
"You should really secure your AWS instance."
"Isnt my SSH key alone a good enough barrier?"
"There are hundreds of thousands of incidents where people either get hacked or commit it to github."
"Well i wont"
"Just start using IP/CIDR based filtering, or i will take your instance down."
"But SSH keys are going to be useless in a couple years due to QUANTUM FUCKING COMPUTING, so why wouldnt IP spoofing get even better?"
"Listen motherfucker, i may actually kill you, because today i dont have time for this. The whole point of IP-based security is that you cant look on Shodan for machines with open SSH ports. You want to talk about quantum computing??!! Lets fucking roll motherfucker. I dont think it will be in the next thousand years that we will even come close to fault-tolerant quantum computing.
And even if it did, there have been vulnerabilities in SSH before. How often do you update your instance? I can see the uptime is 395 days, so probably not fucking often! I bet you "dont have anything important anyways" on there! No stored passwords, no stored keys, no nothing, right (she absolutely did)? If you actually think I'm going to back down on this when i sit in the same room as the dude with the root keys to our account, you can kindly take your keyboard and shove it up your ass.
Christ, I bet that the reason you like quantum computing so much is because then you'll be able to get your deepfakes of miley cyrus easier you perv."8 -
ajax hell/dom hell
do you know it? no dont talk abut the callback hell.
i fcking hate it when i load any modern site, and it needs a few seconds to calc some stuff, xhr this, calc that, dom/css visible that. at all it takes more time specially if you on low end to mid equipmemt.
And then you think its finally loaded, you want to click or tab something and then another xhr was Finished, dom/css changed, and the button i was about to Click moved and i click something else.
friends of me hates this to.
so please dear webdevs, stop try to be cool and fancy just because you found out how "cool" conditions in css and dom is. stop using that bullshit angular (and so on) bullshit if you cant manage to pull out a html at start that will not changr its layout all the time after being loaded, ty.9 -
Have you encountered projects that were beyond saving?
Been freelancing for a client via agency for the past year. In the beginning the deal was to maintain identity verification sdk for android maybe 10-15 hours a month or so. Their flow consisted of around 25-30 screens, so I took it thinking it was easy. Boy I was wrong.
Codebase was and still is a complete spaghetti, backend weird and overcomplicated and impossible to talk with someone in backend. Had to reverse engineer their complicated flows many times just to make a small change on the app. There also are lots of issues with capturing/sending camera recordings especially on older devices. The fact that Im the only dev maintaining this doesnt help either.
First few months it was just maintenance, later some small features and soon it become a 40 hour a month gig. I was able to deal with it but then management changed, they started micromanaging me heavily and now they want me to do 60-70 hours a month. Also they asked to implement some unnecessarily complicated features and to be honest without refactoring most of the codebase I cant even begin to think of how to implement them.
Also workload in my main job increased. Started sacrificing my evenings, weekends and basically my wellbeing to work on their product. Tried to relax but then I realized Im just spending my freetime thinking about their project all of the time. Best part is that last few updates fucked up the whole flow and I dont even understand where the problem is anymore: backend, 3rd party integration issues or something else that I did.
Last friday told them that my availability changed and Im quitting. Told them that Im gonna provide support till the end of the month but no big features. Just spent a full shift in my main job and another full shift working on their product, trying to untagle their spaghetti.. Im totally lost and burned out. Meanwhile stupid manager is asking why "simple" stuff according to him is taking too long.
I should receive my last payment from agency this week, also asked them to send it to me earlier but no answer so far. At this point Im so burned out that I dont care anymore about the last payment, even if client complains that everything is broken and doesnt want to pay me. Project is beyond fucked and that SDK as well as their backend is a ticking time bomb. Im done.12 -
I have not remotely had the energy to post here. Nor reply. And it is a shame because most of you I consider friends. And if not friends, at least excellent aquitances.
People make comments, I dont reply. People make threads, and I dont respond. People make ++s, and I'm a ghost.
I enjoyed shitposting, and asking questions, and hopefully entertaining some of you. I really do.
I'm just in a funk where nothing seems to matter right now and I dont know why, pr how to get out of it.
I have threads, and responses from scor, nanos, nachoscode, and a dozen others I usually enjoy interacting with and it's like all the life has just been sucked right out of me.
I feel isolated and alienated from everything and everyone and I dont know why or when it started. Its just..there. nor how to talk about it.
I think I'm becoming a misanthrope or something. The more I go on with this sensation, the less I want to be around people, and I dont understand why.13 -
I AM TIRED
warning: this rant is going to be full of negativity , CAPS, and cursing.
People always think and they always write that programming is an analytical profession. IF YOU CANNOT THINK IN AN ANALYTICAL WAY THIS JOB IS NOT FOR YOU! But the reality could not be farther from the truth.
A LOT of people in this field whether they're technical people or otherwise, just lack any kind of reasoning or "ANALYTICAL" thinking skills. If anything, a lot of of them are delusional and/or they just care about looking COOL. "Because programming is like getting paid to solve puzzles" *insert stupid retarded laugh here*.
A lot of devs out there just read a book or two and read a Medium article by another wannabe, now think they're hot shit. They know what they're doing. They're the gods of "clean" and "modular" design and all companies should be in AWE of their skills paralleled only by those of deities!
Everyone out there and their Neanderthal ancestor from start-up founders to developers think they're the next Google/Amazon/Facebook/*insert fancy shitty tech company*.
Founder? THEY WANT TO MOVE FAST AND GET TO MARKET FAST WITH STUPID DEADLINES! even if it's not necessary. Why? BECAUSE YOU INFERIOR DEVELOPER HAVE NOT READ THE STUPID HOT PILE OF GARBAGE I READ ONLINE BY THE POEPLE I BLINDLY COPY! "IF YOU'RE NOT EMBARRASSED BY THE FIRST VERSION OF YOU APP, YOU DID SOMETHING WRONG" - someone at Amazon.
Well you delusional brainless piece of stupidity, YOU ARE NOT AMAZON. THE FIRST VERSION THAT THIS AMAZON FOUNDER IS EMBARRASSED ABOUT IS WHAT YOU JERK OFF TO AT NIGHT! IT IS WHAT YOU DREAM ABOUT HAVING!
And oh let's not forget the tech stacks that make absolutely no fucking sense and are just a pile of glue and abstraction levels on top of abstraction levels that are being used everywhere. Why? BECAUSE GOOGLE DOES IT THAT WAY DUH!! And when Google (or any other fancy shit company) changes it, the old shitty tech stack that by some miracle you got to work and everyone is writing in, is now all of a sudden OBSOLETE! IT IS OLD. NO ONE IS WRITING SHIT IN THAT ANYMORE!
And oh my god do I get a PTSD every time I hear a stupid fucker saying shit like "clean architecture" "clean shit" "best practice". Because I have yet to see someone whose sentences HAVE TO HAVE one of these words in them, that actually writes anything decent. They say this shit because of some garbage article they read online and in reality when you look at their code it is hot heap of horseshit after eating something rancid. NOTHING IS CLEAN ABOUT IT. NOTHING IS DONE RIGHT. AND OH GOD IF THAT PERSON WAS YOUR TECH MANAGER AND YOU HAVE TO LISTEN TO THEM RUNNING THEIR SHITHOLE ABOUT HOW YOUR SIMPLE CODE IS "NOT CLEAN". And when you think that there might be a valid reason to why they're doing things that way, you get an answer of someone in an interview who's been asked about something they don't know, but they're trying to BS their way to sounding smart and knowledgable. 0 logic 0 reason 0 brain.
Let me give you a couple of examples from my unfortunate encounters in the land of the delusional.
I was working at this start up which is fairly successful and there was this guy responsible for developing the front-end of their website using ReactJS and they're using Redux (WHOSE SOLE PURPOSE IS TO ELIMINATE PASSING ATTRIBUTES FOR THE PURPOSE OF PASSING THEM DOWN THE COMPONENT HIERARCHY AGIAN). This guy kept ranting about their quality and their shit every single time we had a conversation about the code while I was getting to know everything. Also keep in mind he was the one who decided to use Redux. Low and behold there was this component which has THIRTY MOTHERFUCKING SEVEN PROPERTIES WHOSE SOLE PURPOSE IS BE PASSED DOWN AGAIN LIKE 3 TO 4 TIMES!.
This stupid shit kept telling me to write code in a "functional" style. AND ALL HE KNOWS ABOUT FUNCTIONAL PROGRAMMING IS USING MAP, FILTER, REDUCE! And says shit like "WE DONT NEED UNIT TESTS BECAUSE FUNCTIONAL PROGRAMMING HAS NO ERRORS!" Later on I found that he read a book about functional programming in JS and now he fucking thinks he knows what functional programming is! Oh I forgot to mention that the body of his "maps" is like 70 fucking lines of code!
Another fin-tech company I worked at had a quote from Machiavelli's The Prince on EACH FUCKING DESK:
"There is nothing more difficult to take in hand, more perilous to conduct, or more uncertain in its success, than to take the lead in the introduction of a new order of things."
MOTHERFUCKER! NEW ORDER OF THINGS? THERE 10 OTHER COMPANIES DOING THE SAME SHIT ALREADY!
And the one that got on my nerves as a space lover. Is a quote from Kennedy's speech about going to the moon in the 60s "We choose to go to the moon and do the hard things ..."
YOU FUCKING DELUSIONAL CUNT! YOU THINK BUILDING YOUR SHITTY COPY PASTED START UP IS COMPARABLE TO GOING TO THE MOON IN THE 60S?
I am just tired of all those fuckers.13 -
FFUUUuucccckkk me sideways. So I decided to look into USB type-c's power delivery and alt modes. Cause I kinda want to make an adapter card to run my displays over a single cable. TLDR of the rest: USB-C has some huge capabilities which noone is interested in using since its way to complex to handle for what its worth in the end.
Now PD alone is kinda ok to deal with since a lot of powerbanks use it and some hobby guys documented how to work with it. I find it really odd thou that you NEED to use a dedicated IC for using the configuration chanel to negotiate how much power you can draw. Why the USB standard didnt use some simple 5V low speed signalling? Also the standard says that you only have to implement 5v 0.6A with every other power level being optional. (This is also true for cables. Most manufacturers use only the USB 2.0 standard for them and brag about how fast type-C is. ლ(ಠ益ಠლ) )
Now to the alt modes. These motherfuckers are a real shitshow to deal with. First you need a Mux to deal with USB-C's two way insertion, so your signals wont get flipped. Next thing is that you have four lanes at your disposal in alt mode. Which you can either use for four Display Port Lanes or two DP lanes and two USB 3.0 lanes. (You always get USB 2.0) Now you may think that there would be one simple chip to do it all? Nope you need atleast two at the price of 6$ each. One for PD and one for Alt modes. Both are very hard to solder (QFN, 0.5 mm pitch 40+ pins) TI ended up being the only one with a decent offering of IC's that do what I need. As for working with them, you would think that you just slap a simple MCU on there that communicates over I2C or SPI to configure the chips? Nope! You program the chips memory from which it configures itsself. And the programming is done with some TI tool which gives me no idea as to how you can handle everything whith no control logic behind it.
Looking into alternative IC's leaves me with cypress semi. And their documentation is basically a total mess. I wanna know what that chip is good for and what I need to do to make it work. I dont care about technical details mixed with marketing jargon nobody understands. And I really despise that I have to register just to download a datasheet. Especially since there is no info about it on the main page.
And this whole rant hasnt even touched the topic that USB-C only uses DP and nothing else. So you better hope that you have DP++ so you can use a passive conversion.
This was my Ted Talk about USB-C. Some info in it may be subject to my stupidity and errors as it currently is 02:15 in the morning and I need some sleep.14 -
TLDR: Read the post.
Bare with me here, I am new to all of this jazz. But I wanted to tell a story.
I have been a programmer for a while now, working on various projects with various companies, doing various things. I know that sounds vague, but it's the truth.
I never work on the same thing, ever, I never work with any fancy IDE, because I don't need one. I personally believe no developer works with the massive huge code base all at once, but instead works on it in pieces. That's a story for another day.
I have seen the shittiest of the shittiest and some how survived, I have been beaten down by code bases that were out sourced yet some how managed to stand up and gain my baring and fight back. I have dealt with clients, bosses and idiots from A-Z. Watching them all scramble around for their pennies like greedy rich white men seeking more pennies to swim in.
Some how I survived all this. I started working from home almost 3 years ago, the freedom is exhilarating. The ability to fuck off for most of the day and work at night, or work all morning and fuck off. There's nothing better.
As you work from home you think, this will be amazing. Until the crippling loneliness takes over and even the 6th bottle of beer doesn't quench the thirst of human contact. The pain of being trapped in the four white walls of your office makes that bottle of tequila, to numb out the emptiness inside look more satisfying.
At some point, you crawl out of your space to find people to interact with, refusing to be beaten down by both shit code and loneliness only to find all your friends, family and significant others are working, in offices, where they cant just fuck off for a day with you. The silence of the house, the office, the what ever becomes deafening.
its crawling all over you like bugs that pick away at your mind, breaking you, hating you. So you decide that a coffee shop is the best place, only to sit there and people watch or check Facebook or what ever else people do at coffee shops that isn't actually work.
The point in all of this, is that working from home is both a positive and a negative. It has destroyed me, created a workaholic and, probably, an alcoholic. There isnt a day I dont wish that I could sleep away the deafening silence of the world around me as every one busies off to the office.
One might think: get an office job, but I have become accustomed to my misery, pain and suffering of working from home, isolated and medicated by vaping and alcohol. the freedom, from what I have found, is worth more then the sacrifice of it - to work around people I slowly begin to hate, people that make me want to overdose on anything rather then see their smug faces and be beaten down by their idiotic words, code bases and money grubbing hands...
I guess I'll get back to work now, in my house, with my cats, my vape and my beer. Here's to freedom and the sacrifices that go along with it.5 -
Fuck this day!
Like really fuck it!
I have one of the most terrible crunch-time i ever experienced.
I’v been working 12+ hours every day with an ever-changing project timeline.
It started simple, we made a timeline, it was risky even then but it was realistic, we started working immideatly, everything looked good then a few days in BOOM! Actually our project management completely forgot client B’s projects soo we need to do that too with the same fucking deadline!!! (About 10x more work in waay less time)
Then this morning i got an email from the graphics team that we need to document our design process RIGHT FUCKING NOW! Because management wants documentations, in the middle of a fucking crunch-time.
Today it almost got physical with my project manager, i told him that he is not a programmer, i dont fucking care about his shit, just fuck off and let me work because we won’t be ready based on his unrealistic bs.
I feel like completely fucked over, like we were told 2 days before deadline that the whole company and people’s jobs depends on us now because if we wont finish this clients won’t pay.
WE ARE TWO PROGRAMMERS for studio of 10-12 people!!!
Soo i’w been thinking about getting the fuck out of here ASAP, i got an offer from a pretty big international gamedev company just what i needed, i already did their test before all of this, i passed A+.
We scheduled a skype interview for today. I had completely no time to prepare or chill off, just got out of the office, got into a starbucks and i’m interviewing. No time to even check my mic or internet, the call was so shit i could not hear anything, they neither because the plaza was loud af. Meanwhile im nervous about work, about the interview, about can they hear me at all because of the noise. I fucked it up. BIG time! I was so done i could not reverse a fucking string in c++ or explain what is a signed int!!!
Needless to say they said no.
Need time to think about it or realize what happened? Nice dreams. Back to the office and continue working.
I can’t do this anymore. My girlfriend came for me and took me home at 10pm but all i could do was stare at the floor on the subway. I don’t want people to lose their jobs but i just phisically can’t do this anymore.
Meanwhile any time i talk to my project manager about being tired he says like “hshshsbsb i have 60 hours in the last 4 days i got the worst part, i would be grateful in your place..” like fuck off dude, i dont give fuck about how you feel about this. This is not okay for me, you did this to the project, your fucking job is to manage it! I have one day off before going back to this, i have completely no idea what to do now...
[ps: this is not Nemesys. They did not let me work on my own stuff because i would be a competitor, so i left.]5 -
One of those days when i feel like complete shit and wish i hadn’t woken up.
I heard back from an interview i did last week (one of the faang type) and the recruiter started with “You didn’t impress any of your interviewers”. Man that hurt. I can’t unhear that. He went ahead to say they all recommended a mid-level role for me (they apparently said i had potential and could easily grow into a senior eng) instead of the senior lead i applied for. This is also subject to getting approval to hire mid-level engineers because the team needs more people but they only got approval to hire senior engineers. This cunt also added “dont worry about it. Just go about your usual business and i’ll call you next week if we have gotten the approval”. Ass! All i can do is worry because that is what i do best.
I think i am more sad and disappointed in myself because i thought the interviews went well. Wrote decent code and came up with good solutions on time. Had a good conversation with interviewers. Apparently for a senior, you cannot make mistakes which i did but once the interviewer gave me a clue, i got back on track.
Anyway, i slept with this anxiety, then woke up with tummy ache. On the drive out this morning to go to the bank, i drove my car into a pole and broke off my side mirror. Then my fucking power generator stopped working. And on my way to go and get my fixed mirror from the mechanic, my exhaust pipe broke in half due to a possible pothole i drove into.
Those fucking days where all that could go wrong goes wrong. My head is fucking pounding i can barely move my head without wincing. I am running out of money fast (i support my entire family) and i am worried about not getting a job. This blow to my confidence makes me feel worthless like i am not good for anything. Recruiter suggested i do another senior engineer interview for a different team which i passed the test for but i know the outcome would most likely be the same and i wanted the first team really bad. I just want to lie in bed and cry all day but this fucking headache won’t let me. -
If you think learning a language / working with a language you don't like is offensive to you and your morals .. Then don't do it.
Money is important to you ? Then you're just prostituting yourself to some higher authority. So DONT COMPLAIN!
You have the right to hate stuff while being paid for it. Understandable.
But don't shit on the shit you think is shit just cause you put yourself in the situation of not having an option !!
You're a worthless. Money hungry whore.
Yes, you hate Java/ x language but have to work on it ?
You're either a whore or have serious problems with standing up for yourself, but on the internet you become this amazing troll saying the language has problems.
Half the people who hate languages hate them cause it's common to hate them. Like being racist in the early American ages cause it was "normal".
Brain deficient motherfucking whores. Manipulated cocksuckers.
Sidenote : if you've honestly gotten shit on by a new version of the language you were using .It's understandable and I'm on your side. Using it without thorough research on the other hand is your mistake. Languages aren't ideal. Just Like most women don't like your dick cause, well it doesn't fit their use case. Deal with it not, troll about it.
I'm not like you. I experiment with whatever I like before using it. I work on my own stuff. I suck my own fucking dick and I get paid.
If you honestly disagree with me, put a couple points down on the language you hate and why you hate it ( considering the fact that you have actually used it and are not just trying to disagree with me )21 -
So I joined this financial institution back in Nov. Selling themselves as looking for a developer to code micro-services for a Spring based project and deploying on Cloud. I packed my stuff, drove and moved to the big city 3500 km away. New start in life I thought!
Turns out that micro-services code is an old outdated 20 year old JBoss code, that was ported over to Spring 10 years ago, then let to rot and fester into a giant undocumented Spaghetti code. Microservices? Forget about that. And whats worse? This code is responsible for processing thousands of transactions every month and is currently deployed in PROD. Now its your responsibility and now you have to get new features complied on the damn thing. Whats even worse? They made 4 replicas of that project with different functionalities and now you're responsible for all. Ma'am, this project needs serious refactoring, if not a total redesign/build. Nope! Not doing this! Now go work at it.
It took me 2-3 months just to wrap my mind around this thing and implement some form of working unit tests. I have to work on all that code base by myself and deliver all by myself! naturally, I was delayed in my delivery but I finally managed to deliver.
Time for relief I thought! I wont be looking at this for a while. So they assign me the next project: Automate environment sync between PROD and QA server that is manually done so far. Easy beans right? And surely enough, the automation process is simple and straightforward...except it isnt! Why? Because I am not allowed access to the user Ids and 3rd party software used in the sync process. Database and Data WareHouse data manipulation part is same story too. I ask for access and I get denied over and over again. I try to think of workarounds and I managed to do two using jenkins pipeline and local scripts. But those processes that need 3rd party software access? I cannot do anything! How am I supposed to automate job schedule import on autosys when I DONT HAVE ACCESS!! But noo! I must think of plan B! There is no plan B! Rather than thinking of workarounds, how about getting your access privileges right and get it right the first time!!
They pay relatively well but damn, you will lose your sanity as a programmer.
God, oh god, please bless me with a better job soon so I can escape this programming hell hole.
I will never work in finance again. I don't recommend it, unless you're on the tail end of your career and you want something stable & don't give a damn about proper software engineering principles anymore.3 -
Just another big rant story full of WTFs and completely true.
The company I work for atm is like the landlord for a big german city. We build houses and flats and rent them to normal people, just that we want to be very cheap and most nearly all our tenants are jobless.
So the company hired a lot of software-dev-companies to manage everything.
The company I want to talk about is "ABI...", a 40-man big software company. ABI sold us different software, e.g. a datawarehouse for our ERP System they "invented" for 300K or the software we talk about today: a document management system. It has workflows, a 100 year-save archive system, a history feature etc.
The software itself, called ELO (you can google it if you want) is a component based software in which every company that is a "partner" can develop things into, like ABI did for our company.
Since 2013 we pay ABI 150€ / hour (most of the time it feels like 300€ / hour, because if you want something done from a dev from ABI you first have to talk to the project manager of him and of course pay him too). They did thousand of hours in all that years for my company.
In 2017 they started to talk about a module in ELO called Invoice-Module. With that you can manage all your paper invoices digital, like scan that piece of paper, then OCR it, then fill formular data, add data and at the end you can send it to the ERP system automatically and we can pay the invoice automatically. "Digitization" is the key word.
After 1.5 years of project planning and a 3 month test phase, we talked to them and decided to go live at 01.01.2019. We are talking about already ~ 200 hours planning and work just from ABI for this (do the math. No. Please dont...).
I joined my actual company in October 2018 and I should "just overview" the project a bit, I mean, hey, they planned it since 1.5 years - how bad can it be, right?
In the first week of 2019 we found 25 bugs and users reporting around 50 feature requests, around 30 of them of such high need that they can't do their daily work with the invoices like they did before without ELO.
In the first three weeks of 2019 we where around 70 bugs deep, 20 of them fixed, with nearly 70 feature requests, 5 done. Around 10 bugs where so high, that the complete system would not work any more if they dont get fixed.
Want examples?
- Delete a Invoice (right click -> delete, no super deep hiding menu), and the server crashed until someone restarts it.
- missing dropdown of tax rate, everything was 19% (in germany 99,9% of all invoices are 19%, 7% or 0%).
But the biggest thing was, that the complete webservice send to ERP wasn't even finished in the code.
So that means we had around 600 invoices to pay with nearly 300.000€ of cash in the first 3 weeks and we couldn't even pay 1 cent - as a urban company!
Shortly after receiving and starting to discussing this high prio request with ABI the project manager of my assigned dev told me he will be gone the next day. He is getting married. And honeymoon. 1 Week. So: Wish him luck, when will his replacement here?
Deep breath.
Deep breath.
There was no replacement. They just had 1 developer. As a 40-people-software-house they had exactly one developer which knows ELO, which they sold to A LOT of companies.
He came back, 1 week gone, we asked for a meeting, they told us "oh, he is now in other ELO projects planned, we can offer you time from him in 4 weeks earliest".
To cut a long story short (it's to late for that, right?) we fought around 3 month with ABI to even rescue this project in any thinkable way. The solution mid February was, that I (software dev) would visit crash courses in ELO to be the second developer ABI didnt had, even without working for ABI....
Now its may and we decided to cut strings with ABI in ELO and switch to a new company who knows ELO. There where around 10 meetings on CEO-level to make this a "good" cut and not a bad cut, because we can't afford to scare them (think about the 300K tool they sold us...).
01.06.2019 we should start with the new company. 2 days before I found out, by accident, that there was a password on the project file on the server for one of the ELO services. I called my boss and my CEO. No one knows anything about it. I found out, that ABI sneaked into this folder, while working on another thing a week ago, and set this password to lock us out. OF OUR OWN FCKING FILE.
Without this password we are not able to fix any bug, develop any feature or even change an image within ELO, regardless, that we paid thausend of hours for that.
When we asked ABI about this, his CEO told us, it is "their property" and they will not remove it.
When I asked my CEO about it, they told me to do nothing, we can't scare them, we need them for the 300K tool.
No punt.
No finish.
Just the project file with a password still there today6 -
People now a days dont understand the value of creativity , being a developer means your creativity is also your productivity its your means to keep your job ,pay rent , buy clothes and have something to eat, its just sad to see people demoralize developers for "charging so much" to a project that people think is easy to do. We developers provide outputs and our creativity to the world, i think we deserve more than just a salary, but also a thank you for adding something to the world.3
-
Company top execs: "We need to optimize our costs and reduce our expenditure by x€ to keep the profit margin at acceptable levels for the shareholders"
YOU ARE PUSHING OUT SHIT PRODUCTS DAY IN AND DAY OUT THAT YOU FUCKING SUITS THINK WILL BE THE NEXT BIG THING BUT NOONE REALLY WANTS OR NEEDS. WE ALREADY HAVE A TON OF THOSE BORN-DEAD SHITCAKES HANGING AROUND ABD NEW ONES ARE ALREADY BEING PREPARED FOR LAUNCH.
"OPTIMIZE COSTS"? HOW ABOUT YOU STOP PRODUCING SHIT AND STICK TO YOUR FUCKING CORE BUSINESS MODEL!!!
"OPTIMIZE COSTS"? WE HAVE A ZERG OF OLD FUCKS, WHO ARE STILL WAITING FOR THE FUCKING SMS TO START THE NEXT TECH REVOLUTION, ON OUR PAYROLL. ALL THEY FUCKING DO IS PLAY SUDOKU IN THE KITCHEN AND DISCUSS TECHNIQUES ON HOW TO RAISE GOATS!!!
"NO MONEY TO GIVE A PAYRISE TO DEVELOPERS"? WHY DONT YOU JUST FUCKING GET RID OF THE USELESS DUDES BASICALLY DOING THEIR TENURE AND CLOSE SOME OF THESE FUCKTARDED PRODUCTS THAT 4 PEOPLE OUTSIDE OF THE FUCKING COMPANY USE BUT NEED A TEAM OF FUCKING 20 TO MAINTAIN! NO!!! THEY WILL NOT BE THE NEXT BIG THING! NO!!! ANYTHING YOU SHITCAKES WHO THINK MOBILE APPS IS THE "NEW EMERGING MARKET" WILL EVER CREATE THE NEXT FUCKING BIG THING!!!!!
STICK TO YOUR FUCKING BUSINESS AND STOP CREATING USELESS SHIT THATS MAADE BY FUCKING USELESS PEOPLE!!!!
FUUUUUCCCCCKKKKKK!!!!!!!!!!! -
I joined (still under probation period) in a startup founded by an 18 year old.
I work after my full time job for them and thought itd be fun but the kid made a slack channel and asks for progress updates everyday and feels a bit in a haste to get the product up and running. He seems to think I will be working every weekday from the second i come back home till i sleep. I have a party today that im going to and im sure he will ask for progress updates and when I tell him im out and wont work today he’ll probably say something like “the faster we do the project the better”.
Im not sure if i should leave now while its easy or i should stay for the money ($900 a month). Like i really dont feel like tolerating a demanding kid who cant wait for his app plus id much rather be working on other things just for fun like making rust crates. but at the same time the extra money is nice.
Thoughts?14 -
I got an interview with a big multinational software company as a senior dev - the kind of place I never thought I would be privileged or knowledgeable enough to work for and wasnt expecting to get In to...
I aced it. They gave me an offer but - FOR DEVOPS 😬
basically my skills fit in perfectly with the server/ scaling issues they have and are far more valuable there. I know they do, I also know I can fix the issue and will have alot of fun coding it - I just dont think I want to monitor it or anything else.
I mean I do devops stuff all the time in aid of anything I code but their stack is a full time job- im scared that once the toolchain is automated ill be pulled towards sys admin like duties and lose touch with my craft... what do you guys think? Anyone shifted from dev to devops?9 -
[wk204]
Do whatever makes you happy and dont let your idiot parents pressure you into tech just because they think thats where the money is.5 -
Our company is cheap, cheap as fuck. We have to use some third-party platforms and every year they choose something that is slightly cheaper than the other. (like a few $ per annual), they do not know that we have to refactor our code at the backend because the changes of the platform.
It doesn't end there, they even look for devs from third world countries to work for them remotely instead of hiring permanent staff (I understand it is cheaper because of currency difference and etc), but what about the training period or to let them become comfortable with the existing system, even when he/she is a genius... it takes time to be productive at work.
The worst part is they dont give a shit, they think devs can be replaced easily just like some construction workers carrying stuffs on site (no offence to them), management treating people like shit and doesn't care when they leave.2 -
2017 has ended and I want to throw this fucking rock of anger with it out of the Window.
I will tell you how my last 3 to 4 years as private IT Guy (IT Dumpster) for everything was.
My Gaming Community:
It was so fucking retarded that I would like to punch everyone there in the face over a thousand times.
Seriously there are over 60 People in that Community and they take every shit for granted and only cry about everything.
I'm Paying since 4 Years over 60 € for our Server every month. Some people donated some small bucks over the time and in the end it was around 150 € Donations over 4 years.
Im thankful for the Donations, but these people really think that they can demand for this Donations private Gameservers for over years for free or think that they now own the Servers. WTF?? FUCK YOU!!
Im managing 2 Linux Server with Web, MySQL, Voice and Gameserver. What did 1 guy donate? 10 € for 4 years, thats around 15% for just a month. You would get our Teamspeak for 7 Days for that price idiots!!
I did all the damn Webdev and am now writing a App in Kotlin for Android man!!
Since last everybody in the Community gets on my nerves, because they are so ignorant and dont appreciate the work of others 😡.
My Association where I support the hole IT with a friend:
We decided in the commitee that we would take on major changes in our infrastructure.
We need to finish the barebone concept in the end of January 18.
Early December 17 I wrote my friend, that we need to have a meeting and plan everything.
Well, now I mostly designed the roadmap by myself and didnt receive any reply from my friend 💀.
I really dont understand why the shit always sticks at me and I need to finish it.
I really love to code something, install or repair PC's with joy or manage Server but the people around me are in my free time like poison and they take out my fun for it.
The only fun and enjoyable IT Part for me is at my fulltime job. Thats the only good place left for me as Safe Heaven and the people there really appreciate my knowledge and work I do.7 -
[See image]
This guy is wrong in so many ways.
"Windows/macOS is the best choice for the average user. Prove me wrong."
There are actually many Gnu/Linux based operating systems that's really easy to install and use. For example Debian/any Debian based OS.
There are avarage users that use a Gnu/Linux based operating system because guess what. They think its better and it is.
Lets do a little comparision shall we.
- - - - - Windows 10 - - Debian
Cost $139 Free
Spyware Yes. No
Freedom Limited. A lot
"[Windows] It's easy to set up, easy to use and has all the software you could possibly want. And it gets the job done. What more do you need? I don't see any reason for the average joe to use it. [Linux]"
Well as I said earlier, there are Gnu/Linux based operating systems thats easy to set up too.
And by "[Windows] has all the software you could possibly want." I guess you mean that you can download all software you could possibly want because having every single piece of software (even the ones you dont need or use) on your computer is extremely space inefficient.
"Linux is far from being mainstream, I doubt it's ever gonna happen, in fact"
Yes, Linux isn't mainstream but by the increasing number of people getting to know about Linux it eventually will be mainstream.
"[Linux is] Unusable for non-developers, non-geeks.
Depends heavily on what Gnu/Linux based operating system youre on. If youre on Ubuntu, no. If youre on Arch, yes. Just dont blame Linux for it.
"Lots of usability problems, lots of elitism, lots of deniers ("works for me", "you just don't use it right", "Just git-pull the -latest branch, recompile, mess with 12 conf files and it should work")"
That depends totally on what you're trying to. As the many in the Linux community is open source contributors, the support around open source software is huge and if you have a problem then you can get a genuine answer from someone.
"Linux is a hobby OS because you literally need to make it your 'hobby' to just to figure out how the damn thing works."
First of all, Linux isnt a OS, its a kernel. Second, no you dont. You dont have to know how it works. If you do, yes it can take a while but you dont have to.
"Linux sucks and will never break into the computer market because Linux still struggles with very basic tasks."
Ever heard of System76? What basic tasks does Linux struggle with? I call bullshit.
"It should be possible to configure pretty much everything via GUI (in the end Windows and macOS allow this) which is still not a case for some situations and operations."
Most things is possible to configure via a GUI and if it isnt, use the terminal. Its not so hard
https://boards.4chan.org/g/thread/...
21 -
# school suck
! coding
hello, hope im not bothering anyone with my adolescent problems, but im really angry towards school.
first of all,
the subjects get thaught much too slow.
like dafuq, why does our maths teacher need 6h to teach us what square roots are? Why does our history teacher need 10h to teach us about one single revolution???
and worst of all: why is everything accompagnied by long, repetitive, homework?
Also, why do they think that im bad just because i dont have the best grades??? im a GOOD average, without learning a TAD!!!
also, here i am, needing to learn maths for some it project.
when i ask any teacher, he doesnt explain it to me but says "you will learn that in class xy"
ok, then i guess i can teach it myself.
but when i take books into school to read em (remember, i already know the subjects), the teachers always take em from me.
also, im not allowed to talk to anyone. not even when idle.
so currently, i am trying not to get angry from this, tomorrow school starts again. after this year legally, i would be allowed to drop out.
could you please tell me what you would do? should i drop out? change school? change class? im open to reolly anything that possibly could help (my parents arent)35 -
I am thinking about leaving this platform. To be honest I don't get anything out of it anymore and the only thing keeping me here is the less-rant'ish content like @devNews or the stories.
I am actually a bit disappointed, the quality of devrant really did degrade alot in the last few months. Don't get me wrong but I feel like people have become "normies" over here. I don't mean that in an edgy or degrading way but let me explain. When I started here I had a very high opinion of the people here. Everyone seemed like a passionate / knowledgeable individual from whom you could hear interesting stories or learn. Maybe I just saw it like that because I was still a very inexperienced dev and was looking for a dev community. But nonetheless I think devRant transformed into a place of mediocrity.
Dont get me wrong I wouldn't think of myself as aspiring or generally "better" than anyone else on here, but the content over here got a little stale.
I am not the kind of person who would "rant", in the first place, so I may have a different mindset and to be honest "ranting" has always been a thing I looked down upon. It just does not support my style of thinking. I totally get that people sometimes need to "vent" their feelings but there is nothing productive to gain from ranting, like you ain't not improving your situation by doing it. The more passionate raters over here call people things, I would never even dream about saying to people. Don't worry I'm no sjw or something like it, I don't care if you do it. If it helps you sure, why not. But there is a point where you corner yourself so much that you stop respecting your colleagues because they wrote that shitty code, instead of helping.
Some tech sure is bad, but it is not getting any better by insulting it.
Another thing I use to notice are people, thinking so highly of them selfes / being so close-minded - that they only accept their own views as true. These are the people that I always try to avoid, but that is getting harder and harder as time goes on.
Collectivism and group thinking are very strong on devRant making it really hard to defend a unpopular opinion - I get that devRant is not the kind of platform that would support actual proper arguments/discussions - but I still feels like some people shove opinions down another people's throat with no reasoning behind it.
Arguments on devRant are always won by the person coming up with the most witty response. Having another opinion is always seen as offensive. That's not exactly the definiton of open-mindedness.
Another rather annoying thing are what I call the "non dev, dev's". See: As a developer you should aspire to understand what your doing - I won't get into this too much but one sentencd: How are things like serious "Semicolon memes" a thing? I am as much into memes as the next guy, but debugging 3 hours, just to find out its a typo. I mean come on...
I sure get that devRant is not the kind of place where you would find the people I am looking for, and that's why I am leaving.
My whole post may seem super negative of the platform - and it is to an extend - but I sure also had a good time back in the day - devRant as in "the platform" surely is not at fault, but a forum is only as good as the people on it. Maybe I changed, maybe devRant did. All I know is that it is not for me anymore.
I won't delete my account and I probably will not leave completely, but all I will do is the "once a week" checkout.6 -
Holy fucking shit... this didnt happen! IT FUCKING CAMT HAVE! NO NO NO NO! IMPOSSIBLE!
I LOST MY FUCKING BAG! RIGHT BEFORE ONE OF MY MOST IMPORTANT FUCKING TESTS! Ok, a little backstory, everyone in Switzerland or (due to alice's request) german can skip this part:
Here we have something called a "Lehre" (I think its called an apprenticeship or sth?) which usually goes 3-4 years, and in the middle, (end of 2nd) we have a "Teilprüfung" Which is basically a test which you HAVE to pass, if you dont, wait another year, and do it with the Final exams... and if you dont pass, your fucked. very very deep in the ass. And guess where I am? Yes. end of 2nd year. And guess what happened?
I LOST ALL OF MY STUFF! GONE. LOST. IM SO FUCKING SCREWED RIGHT NOW! (I have a small backup tho) BUT THIS IS JUST BAD! VERY FUCKING BAD!
OH GOD...
WHY THE FUCK ISNT THIS A DREAM!
I cant sleep...
send help.
fucking srsly.
send help.4 -
Quited my Job.
So... How to spend half a salary in a day...
Go to the shrink after like 3 years of not completing my burn out treatment.
Btw been having health problems lately, incapacitating stuff.
Got so many medication that im using a grossery bag.
Also had to quit my job... I just can't work can barely think, have no strength and a pressure in my head all day.
Now.. I was a temp, working in shifts on a shitty badly paid job, so fk it. 3 weeks down time, then I just quitted...
Now, on my parents house, getting 1 day of sick leave means a person doesn't want to work... How am I gonna tell them that I quitted... Lol
A few years ago I had to ear stuff like your lazy and don't want to work up to the day I got couth trying to cut my wrists... And I'm against suicide.
Now I dont know if I should hope my recent health problems are burn out related or not... Because some of the other possibilities are quite bad... I mean worst.
Can't think, fealing depressed because I hate to not be able to give 100%... And I just keep looking at my CNC machine... Finnaly got enough pieces to finish my project, but I can't get the will to do so... And it's there, in front of me, the opportunity to create my own job...
Life sucks5 -
A /thread.
I have to say something important. As the story progresses, the rage will keep fueling up and get more spicy. You should also feel your blood boil more. If not, that's because you're happy to be a slave.
This is a clusterfuck story. I'll come back and forth to some paragraphs to talk about more details and why everything, INCLUDING OUR DEVELOPER JOBS ARE A SCAM. we're getting USED as SLAVES because it's standardized AS NORMAL. IT IS EVERYTHING *BUT* NORMAL.
START:
As im watching the 2022 world cup i noticed something that has enraged me as a software engineer.
The camera has pointed to the crowd where there were old football players such as Rondinho, Kaka, old (fat) Ronaldo and other assholes i dont give a shit about.
These men are old (old for football) and therefore they dont play sports anymore.
These men don't do SHIT in their lives. They have retired at like 39 years old with MULTI MILLIONS OF DOLLARS IN THEIR BANK ACCOUNT.
And thats not all. despite of them not doing anything in life anymore, THEY ARE STILL EARNING MILLIONS AND MILLIONS OF DOLLARS PER MONTH. FOR WHAT?????
While i as a backend software engineer get used as a slave to do extreme and hard as SHIT jobs for slave salary.
500-600$ MAX PER MONTH is for junior BACKEND engineers! By the law of my country software businesses are not allowed to pay less than $500 for IT jobs. If thats for backend, imagine how much lower is for frontend? I'll tell you cause i used to be a frontend dev in 2016: $200-400 PER MONTH IS FOR FRONTEND DEVELOPERS.
A BACKEND SOFTWARE ENGINEER with at least 7-9 years of professional experience, is allowed to have $1000-2000 PER MONTH
In my country, if you want to have a salary of MORE THAN $3000/Month as SOFTWARE ENGINEER, you have to have a minimum of Master's Degree and in some cases a required PhD!!!!!!
Are you fucking kidding me?
Also. (Btw i have a BSc comp. sci. Degree from a valuable university) I have taken a SHIT ton of interviews. NOT ONE OF THEM HAVE ASKED ME IF I HAVE A DEGREE. NO ONE. All HRs and lead Devs have asked me about myself, what i want to learn and about my past dev experience, projects i worked on etc so they can approximate my knowledge complexity.
EVEN TOPTAL! Their HR NEVER asked me about my fycking degree because no one gives a SHIT about your fucking degree. Do you know how can you tell if someone has a degree? THEY'LL FUCKING TELL YOU THEY HAVE A DEGREE! LMAO! It was all a Fucking scam designed by the Matrix to enslave you and mentally break you. Besides wasting your Fucking time.
This means that companies put degree requirement in job post just to follow formal procedures, but in reality NO ONE GIVES A SHIT ABOUT IT. NOOBOODYYY.
ALSO: I GRADUATED AND I STILL DID NOT RECEIVE MY DEGREE PAPER BECAUSE THEY NEED AT LEAST 6 MONTHS TO MAKE IT. SOME PEOPLE EVEN WAITED 2 YEARS. A FRIEND OF MINE WHO GRADUATED IN FEBRUARY 2022, STILL DIDNT RECEIVE HIS DEGREE TODAY IN DECEMBER 2022. ALL THEY CAN DO IS PRINT YOU A PAPER TO CONFIRM THAT I DO HAVE A DEGREE AS PROOF TO COMPANIES WHO HIRE ME. WHAT THE FUCK ARE THEY MAKING FOR SO LONG, DIAMONDS???
are you fucking kidding me? You fucking bitch. The sole paper i can use to wipe my asshole with that they call a DEGREE, at the end I CANT EVEN HAVE IT???
Fuck You.
This system that values how much BULLSHIT you can memorize for short term, is called "EDUCATION", NOT "MEMORIZATION" System.
Think about it. Don't believe be? Are you one of those nerds with A+ grades who loves school and defends this education system? Here I'll fuck you with a single question: if i gave you a task to solve from linear algebra, or math analysis, probabilistics and statistics, physics, or theory, or a task to write ASM code, would you know how to do it? No you won't. Because you "learned" that months or years ago. You don't know shit. CHECK MATE. You can answer those questions by googling. Even the most experienced software engineers still use google. ALL of friends with A+ grades always answered "i dont know" or "i dont remember". HOW IF YOU PASSED IT WITH A+ 6 DAYS AGO? If so, WHY THE FUCK ARE WE WASTING YEARS OF AN ALREADY SHORT HUMAN LIFE TO TEMPORARILY MEMORIZE GARBAGE? WHY DONT WE LEARN THAT PROCESS THROUGH WORKING ON PRACTICAL PROJECTS??? WOULDNT YOU AGREE THATS A BETTER SOLUTION, YOU MOTHERFUCKER BITCH ASS SLAVE SUCKA???
Im can't even afford to buy my First fuckinf Car with this slave salary. Inflation is up so much that 1 bag of BASIC groceries from Walmart costs $100. IF BASIC GROCERIES ARE $100, HOW DO I LIVE WITH $500-600/MONTH IF I HAVE OTHER EXPENSES?
Now, back to slavery. Here's what i learned.
1800s: slaves are directly forced to work in exchange for food to survive.
2000s: slaves are indirectly forced to work in exchange for money as a MIDDLEMAN that can be used to buy food to survive.
????
This means: slavery has not gone anywhere. Slavery has just evolved. And you're fine with it.
Will post part 2 later.8 -
I made a post how i experienced a mental breakdown yesterday, a total mental collapse from abnormal dose of studying for college. Here a new day and i still cannot function properly. I cant describe the feeling exactly but feels like my brain is fried by electric shock wave... Like some kind of mild passive aggressive depression of void and nothingness.
During mental breakdown it was so bad that i could not construct basic sentences and comminicate until sleeping for a few hours and resetting myself that way. Now i can but i still cant think or do the coding work. My brain just feels fried... If you never had a mental breakdown just imagine a burnout and then multiply that by 1 million
I dont know what to do
I need help10 -
Oh no AI can destroy hummanity in the future! It is like skynet and such... Bad! It will be the end! FEAR THE AI!
Yeah so i cant sleep now so im writting a rant about that.
What a load of bullshit.
AI is just a bunch of if elses, and im not joking, they might not be binary and some architectures of ML are more complex but in general they are a lot of little neurons that decide that to output depending on the input. Even humans work that way. It is complicated to analyse it yes. But it is not going to end humanity. Why? Because by itself it is useless. Just like human without arms and legs.
But but but... internet.... nukes... robots! Yeah... So maybe DONT FUCKING GIVE IT BLOODY WEAPONS?! Would you wire a fucking random number generator to a bomb? If you cant predict actions of a black box dont give it fucking influence over anything! This is why goverment isnt giving away nukes to everybody!
Also if you think that your skynet will take control of the internet remember how flawless our infrastructure is and how that infrastructure is so fast that it will be able to accomodate terabytes per second or more throughput needed by the AI to operate. If you connect it to the internet using USB 2.0 it wont be able to do anything bloody dangerous because it cant overcome laws of physics... If the connection isnt the issue just imagine the AI struggle to hack every possible server without knowing about those 1 000 000 errors and "features" that those servers were equiped with by their master programmers... We cant make them work propely yet alone modify them to do something sinister!
AI is a tool just like a nuclear power. You can use it safely but if you are a idiot then... No matter what is the technology you are going to fuck shit up.
Making a reactor that can go prompt critical? Giving AI weapons or controls over something important? Making nukes without proper antitamper measures? Building a chemical plant without the means to contain potential chemical leak? Just doing something stupid? Yeah that is the cause of the damage, not the technology itself.
And that is true for everything in life not only AI.5 -
Check in, check out, punch in punch, out, wax on (my balls), wax off. Do your duty. Be a good citizen. Work overtime. Conserve the environment: buy a tesla that runs on afghan lithium conflict minerals. Post your life to facebook. Get married. Have exactly 2.5 kids.
Use jquery. Use knockout. Use react. Use vue. Use svlete. Use heroin. Used needles. Used people. Used toilet paper. Toilet paper apocalypse. Social trends. Be a good citizen.
Watch tv. Watch nightly news. CNN says. Fox news says. Hey, did you read this article by important funny guy on tv? American taliban. Scary. Be afraid. Hey did you read this article on cute puppies? Funny! Did you see this meme? What a funny meme! HAHAHA. Do we need prisons for dissidents? Do we need to release all the prisoners in federal prison? Should we round up people who dont follow health authorities? Science says. Science is wrong. Science is right. Man in robe agrees with me. Man in robe disagrees with me. You're evil. These people are bad. Is doing bad always wrong? Should we tolerate intolerance? Its time to stop tolerating intolerance. Be an individual, like everyone else. Be you. Be the best you that you can be. Individualism. But we're all in this together. We're all different and unique. But we're all the same. Love each other. Love humanity. But not these guys over here. Punch a nazi. Punch a commie. Isn't it time we punched a nazi? Isn't it time we had socialism? Isn't it time the old get out of the way for the young? Why are the old hateful? Why do they horde all the money? Do we need rent controls? We need rent controls. Its time for rent controls. I think I believe what others believe. Believe different. Think different. Apple. An apple a day keeps the windows away. Open windows, a breathe of fresh air. Is climate change real? We need to have a national conversation about climate change! The world is freezing. The world is flooding. We're all gonna drown. The world is overpopulated. We need to talk about overpopulation. People who have too many kids are polluting the world. America doesnt have enough kids! Is it time to bring in more immigrants to have more kids? Who will work the fields? Thats racist. Is racism an epidemic? Is white flight an epidemic? Lets talk about epidemics. Lets have a conversation about mandatory vaccination. Lets have a national conversation about mandatory pandemics. I mean, vaccinations. Lets change the world. Trust the science. Don't trust the science. Bu-bu-bu-bu-bu I'm loving it. Love who you are. Live love laugh. If you don't love me at my best, then you can't handle me at my worst. People who disagree with [current year] are the worst. Is it time to regulate speech? Its time to regulate speech. Should there be laws against hatespeech. I think there should be laws against hatespeech. People who upset me should go to jail. Its current year. Think big. Think outside the bun. Have it your way. All the time, always. All for freedom, freedom for all. Because this is america, and current year. I like to work hard. But you have to remember to play hard too. Work hard. Play hard. With a childlike sense of wonder. Be you. Belong anywhere. Just do it. Challenge Everything. Because you're worth it. Save money...live better...have an abortion. You're in good hands. Democracy dies in darkness. Is it time to regulate hatespeech. Politician in current year is hurting our democracy. War is a racket. We need to liberate afghanistan. Why are we bombing afghanistan? Its there culture. They're oppressing people! Don't criticize anyones culture. Be kind. Rewind. Go further. Lets go places. Because Impossible is Nothing.
Lets change the world. I'm a smart passionate funny guy with a childlike sense of wonder and play. You ever want to travel? I want to travel. See the world. Eat new food. Eat. Love. Pray. Eat love. kill. Is meat murder? I think meat is murder. Go vegan. Go home. Order out. Support your local economy. Think global, act local. I'm a good corporate citizen. Be the change you want to see. Did you hear about this local brewery? Do you like craft beer? Hey try this new IPA. I shared it on twitter. Twitter is a very important part of my life. I think what other people say matters, and them reading what I think matters. What I ate for lunch matters. Hey what did you eat for lunch? I LOVE FOOD. You want to order door dash. There new commercial is amazing. Commercials are SO FUNNY. Hey did you see this meme of this commercial? I shared it on tiktok. Heres a funny dance. Watch these nurses dance. I wish I could dance like that. They're so overworked. So brave. Our hospitals are overflowing. People are dying. Hey did you see this new dance trend on tiktok? I like tiktok. I think its a very important part of life to share your life with others. Nurses are dying. Look at this image of hospitals. Scared. Very scary. Very bad. Bad and scary. Big thoughts! Thoughts and prayers!
Because Yes we can!
Beep boop.7 -
It is the time for the proper long personal rant.
Im a fresh student, i started few months ago and the life is going as predicted: badly or even worse...
Before the university i had similar problems but i had them under control (i was able to cope with them and with some dose of "luck" i graduated from high school and managed to get into uni). I thought by leaving the town and starting over i would change myself and give myself a boost to keep going. But things turned out as expected. Currently i waste time everyday playing pc games or if im too stressed to play, i watch yt videos. Few years ago i thought i was addicted, im not. It might be a effect of something greater. I have plans, for countess inventions, projects, personal, for university and others and ALL of them are frozen, stopped, non existant. No motivation. I had few moments when i was motivated but it was short, hours or only minutes. Long term goals dont give me any motivation. They give as much short lived joy, happines as goals in games and other things... (no substance abuse problems, dont worry). I just dont see point of my projects anymore. Im sure that my projects are the only thing that will give me experience and teach me something but... i passed the magic barrier of univercity, all my projects are becoming less and less impressive... TV and other sources show people, briliant people, students, even children that were more succesful than me
if they are better than me why do i even bother? companies care more for them, especialy the prestigious ones, they have all the fame, money, funding, help, gear without question!
of course they hardworked for ther positions, they could had better beggining or worse but only hard work matters right?
As i said. None of my work matters, i worked hard for my whole life, studing, crafting, understanding: programming, multiple launguages, enviorements, proper and most effcient algorithms, electronic circuits, mechanical contraptions. I have knowlege about nearly every machine and i would be able to create nearly everything with just access to those tools and few days worth of practice. (im sort of omnibus, know everything) But because had lived in a small town i didnt have any chances of getting the right equpment. All of my electronical projects are crap. Mechanical projects are made out of scrap. Even when i was in high school, nobody was impressed or if they were they couldnt help me.
Now im at university. My projects are stagnant, mostly because of my mental problems. Even my lifestyle took a big hit. I neglect a lot of things i shouldnt. Of course greg, you should go out with friends! You cant dedicate 100% of your life to science!
I fucking tried. All of them are busy or there are other things that prevent that... So no friends for me. I even tried doing something togheter! Nope, same reasons or in most cases they dont even do anything...
Science clubs? Mostly formal, nobody has time, tools are limited unless you designed you thing before... (i want to learn!, i dont have time to design!), and in addition to that i have to make a recrutment project... => lack of motivation to do shit.
The biggest obstacle is money. Parts require money, you can make your parts but tools are money too. I have enough to live in decent apartment and cook decently as well but not enough to buy shit for projects. (some of them require a lot or knowlege... and nobody is willing to give me the second thing). Ok i found a decent job oppurtunity. C# corporation, very nice location, perfect for me because i have a lot of time, not only i can practice but i can earn for stuff. I have a CV or resume just waiting for my friend to give me the email (long story, we have been to that corp because they had open days and only he has the email to the guy, just a easier way)
But there are issiues with it as well so it is not that easy.
If nobody have noticed im dedicated to the science. Basicly 100% scientist that want to make a world a better place.
I messaged a uni specialist so i hope he will be able to help me.
For long time i have thought that i was normal, parent were neglecting my mental health and i had some situations that didnt have good infuence on me as well. I might have some issiues with my brain as well, 96% of aspargers symptoms match, with other links included. I dont want to say i have it but it is a exciuse for a test. In addition to that i cant CANT stop thinking, i even tried not thinking for few minutes, nope i had to think about something everytime. On top of that my biological timer is flipped. I go to sleep at 5 am and wake up at 5pm (when i dont have lectures).
I prefer working at night, at that time my brain at least works normaly but i dont want to disrupt roommates...
And at the day my brain starts the usual, depression, lack of motivation, other bullshit thing.
I might add something later, that is all for now. -
I hate people who think they are always right.
A coworker who seemed to be a friend turns out to be an emotionally needy narcissist who seems to think that he is a perfect human being and is the best example of how to live.
Long story short is that we did some bonding via alcohol and smoking cigarettes. Especially when I was in a bad period in my life where I had little self confidence, was in a bad financial situation and overshared many details abound my personal life.
And yeah we also work as software devs in the same team but I started avoiding working with him directly, because due to his seniority he overcomplicates things a lot to the point where stuff gets postponed for months. Meanwhile I am a simple guy, I do my tasks and if they are not up to the standard I just work on the feedback until Im up to the standard, thats it. Its just a job for me, for him its a way of life and he considers himself to be basically an artist.
Hes always trying to prove me something, showing that the "long way" is the best way and so on. In reality I dont give a fuck about him. I live my own life and I have my own priorities. I work fulltime in one job, also I work part time as a freelancer and in total I make about 20 percent more than he does. Previously before this job I owned my own company where for 2 years I ran my own projects which generated a decent revenue. I know what is hard work and how to sacrifice myself in order to achieve results. I am more pragmatic and I have some limitations of what I can be good at (since I have a shitty working memory due to my ADHD). So I have systems in place and bottom line is that I earn a decent living and my skillset is different. Yeah I agree that in some ways he is better than me, but dude has such a massive inflated ego that now he thinks that he unlocked some sort of universal wisdom and now hes suddenly experienced in every field of life and his opinion is the right one.
This guy takes a massive pride in how good software engineer he is and in every topic or interaction he tries to one up me. Which most of the time is just his preference or in order to gain a 0.0001 percent performance increase. Dude is basically a big walking ego and since "we are close now" his ego started bleeding into personal relationship.
In my personal life, Im in a stable relationship, thinking of proposing soon and getting married. I already co-own an apartment with my current girlfriend. Everything is serious and planned, Im soon to be 30 years old. He is the same age but he still thinks hes young hot shit and all he cares about is getting shitfaced a couple times a week after work and he doesnt really have any other hobbies. He has a girlfriend but I dont see any future in there TBH.
So what I did now is I started putting some distance between us. No more drinking every week with him, maybe maximum once in 2 or 3 weeks. I started working from home more. Also I stopped sharing my personal life with him. Each time when he thinks he is right I just go along with it and dont even pay attention to his emotional manipulations. I just hope one day he fucks off completely and I wont give in to his gaslighting. Maybe in a few months I will be leaving this job, so I will never have to deal with him again.
Lesson learned: dont be vulnerable to coworkers who you bond together only via alcohol.3 -
Hey! This is a followup to my last story.
TL;DR: I thinking of quitting my old job, got an offer at a startup, about the same pay, but much better working conditions.
First of all, the meeting with my lead. It was a performance report on her side to me, and I got 100 to 110% in performance in all points. My lead said "this team without you wouldn't be this team anymore" - which makes me feel a little bit bad for her if I decide to quit. She is a great team lead, but I don't belive the old company is worth my time anymore.
Now to the new company. Shortly after that performance report meeting, I had a call with the ceo, and what do I have to say besides: What a cool dude. He listened to me, asked me questions about my previous jobs (not just as programmer) and so on. But because first looks are deceiving, I went to their office last thursday. And wow. Their are exactly what I imagined them to be. Cool, young folks, 100% tech enthusiasts, and open minded.
One of the new hires in the new company wanted a 6 months internship between his studies. Instead they offered him a full time job - for the 6 months. They even offered me to pay back my scholarship that I will own my old company for leaving early. This is awesome.
The only things that will be worse than my old job are, that I have to negotiate payment instead of yearly increases, 4 days less paid vacation, so only 26 days, and 40h weeks. And they have no workers council, which isn't good, but it's not the worst either.
I got them fixed on 57.000€, not including an up to 10.000€ annual bonus. The way you achieve your bonus seems good to. It's split in two parts, internal and external bonus. Internal bonus is when you engage with internal events like tech calls, sharing your knowledge on your main IT topics, etc. External Bonus is a bit more complicated, but also straight forward. You work on projects for customers, and if you have less than 3 weeks a year that you dont participate in an project, you get the full bonus.
Last friday, I filed a request for a certificate of employment from my current team lead, this is odd for her because I have never done it before, and she asked why I requested it. I said to her that we can talk about it, and she agreed but didn't call me, yet.
Lastly, another good friend of mine will be employed by my team soon, but for a fraction of the payment that I currently receive! He is doing the exact same work, and even worse, he is doing project managment for his main developer project too! And is getting less paid... I just cant...
Yesterday we needed to update a few cloud instances, the only other person who knows about setting up CICD and our OpenShift Containers than me is only in part time and works two days a week, his trainee didn't know anything, so it's up to me. This isn't hard or anything, but it shows that this system our mangement maintains will fail soon, maybe even with me going? I sure hope so tbh.
One of you guys said, I should go to my team lead and negotiate a higher pay, but the truth is, that because we are a big ISP we have an collective agreement for payment and are grouped by tasks (which is bull shit btw, because I'm doing tasks much higher paid than currently). This also means that I cannot simply jump in another group, and can only increase my current pay to about 115%, which is done automatically every year by 5% up to 115%. Anything above is considered extra, but I don't think they will go with it.
I will decide this week about my future at the old company, but I really don't know what to do...2 -
iiiii fffffuckingg hate articles that just explain something
put a piece of code
that piece of code uses X amount of classes/models
they never mention what structure are those models/classes made of
what is inside them
i cant continue following the article because i dont know what is inside them
they just put it in ur face and say Fuck you
no
Fuck YOU
<font size="1000000px;">FUCK</font>
<font size="10000000000000000em;">YYYYYYYOOOKUUUUUUUUUUU</font>
U MOTHFFFFFUCKERRRRRRRRRRRRRRRRRRRR
USELESSS ARTICLE
zzzzz
frustratioms
my nerves are torn
broken
disabled
demented
day
in life
obsession
hell
unreal
what is life
q
what are doing
why are doing this
what is the point of living
how long does it take for a man to die
why are some people blessed with luck and some are not
zzzz
u know what is even more frustrating
girls
yes
ohdont get me started on this topic
well i warned u
the path towards abundance lies upon the few; thou who shalt not risk high; shalt always stay thus low
girls also frustrate me bc
i always do every thing nice and im always nice
so i realized
being nice is fake as fuck and doesnt fuckin work
being urself doesn't do a Fckimg tHING
hhh
frustrations
.
breathe
.
in this hardlife
only the strong survive in this world
- tupac shakur
zzzz
so yes bavk where i was saying girls frustrate me because i always do what im supposed to
so
i tried being thou who shalt i am not
guess what mothrfucker
it works when u be a gofdamn fkig low mothfckr a u know a goddmn fkig punk then they respect u and want u
back i fckked up
i turned back to my real me, the nice me
and then they left me
they think being nice = means being weak
FUCCKK YOUU
ssss
zzzf
kindness != weakness
U FCKING WHORES
UNDERSTAND THAT
zzzzz
breathe
i just wanted to have a walk outside and thenit started raining
so i had to stay inside bc of the rain
m
i am very lonely
u know i was very fine when i was lonely at a very young age but now i need a living entity beside me
with me
i fking need
wait i will cuddle my fluffy dog rn maybe i will feel better
br b wait for me ok
i feel better now
fck
i remembered that goddamn girl again
man i feel so heart broken
srsly
i have sunk into the deepest depths of endless depression I think
it doesnt feel nice
it feels very lonely and depressing down here
but i thimk tjat is be because i care too much
some people say i overthink
I dont overthink
i am like the stealth people
the shadow people
i stay quiet and observe
everything
i always know what is happening but i rarely speak about it
and people dont realize
so they think they can fool me
no
everything has its limits
so much lies that im sick of it
i always tell it how it is
i always reward those who help me
i always help those who help me
i never forget those people
zzzZZ
why is it that people who dont give a single fucking Fffffficxkkckck about me
are the ssame people i almost care the MOST?
i cross hundreds and thousands of miles to visit a person, invest hours of my time to do that
i do that....
and they wouldnt even step 1 foot in front to see me....
what kind of life is this
vv
feel like cryin rn
.
zzzzz
.
i dont understand what one must do
what is the point
all i want is to be happy
that is it
but being happy is.... i wanted to say the hardest part of life but now my voice told me being happy is a state of mind
myself answered me that being happy ? is a state of mind?
so that means if i want to be happy even if everything around me is falling apart
in my mind i can create a psychological world that would make me.... happy ....?
or what
i dont understand what did myself tell me
why do i care so much if im lonely
u know my friend from college we go to same computer science college
hes a very smart man but a fake FUCKING friend, plastic as fuck
he reads philosophy booms and told me
"when a man is lonely for long enough, he will slowly start to fall apart"
that is me...... that is ...truth......
he quoted a philosopher from some book
zzzz
he also said a quote he read about the meaning of life
"this life is endless pain and the only purpose of life is to reduce this pain as much as possible so we can be happy"
what the fck that is incredibly depressing
what the fuck im actually crying rn
i feel stabbed in the back and left behind and cheated on, all of those happened and some of them are happening right now
dont know what to think about the reasons
all of this causes me such huge anger and depression and that is whT keeps me going
going by working harder than i am supposed to
without all this hurt there would be no glory
all this effort..... it better pay off at the end...... please God..... i beg you....
i have completed 50% of my life purpose, let me do the rest so i can die in peace...13 -
I never understood the ‚space vs tabs‘ war ...
Tabs can do everything that spaces can plus more:
* look the same as spaces, but its width is configurable (at least in a decent editor)
* the safe space (1 byte vs 3 or 4)
* you can decrease the intendation leven with one bsckspace keypress in every(!) editor.
So the winner can only be tabs? Why would I even limit myself with spaces?
I dont wanna start a flame war, just curious what you guys (especially the spaces lovers) think about it10 -
I know I’ll get mixed views for this one...
So I’ll state my claim. I agree with the philosophy of uncle bob, I also feel like he is the high level language - older version of myself personality wise.. (when I learned about uncle bob I was like this guy is just like me but not low level haha).
Anyway.. I don’t agree with everything because I think he thinks or atleast I get the vibe he thinks everything can be solved by OOP, and high level languages. This is probably where Bob and I disagree. Personally I don’t touch ruby, python and java and “those” with a 10 foot pole.
Does he make valid arguments, yes, is agile the solve all solution no.. but agile ideas do come natural and respond faster the feedback loop of product development is much smaller and the managers and clients and customers can “see things” sooner than purly waterfall.. I mean agile is the natural approach of disciplined engineers....waterfall is and was developed because the market was flooded with undisciplined engineers and continues to flood, agile is great for them but only if they are skilled in what they are doing and see the bigger picture of the forest thru the trees.. which is the entire point of waterfall, to see the forest.. the end goal... now I’m not saying agile you only see a branch of a single tree of the forest.. but too often young engineers, and beginners jump on agile because it’s “trendy” or “everyone’s doing it” or whatever the fuck reason. The point is they do it but only focus on the immediate use case, needs and deliverables due next week.
What’s wrong with that?? Well an undisciplined engineer doing agile (no I’m not talking damn scrum shit and all that marketing bullshit).. pure true agile.
They will write code for the need due next week, but they won’t realize that hmm I will have the need 3 months from now for some feature that needs to connect to this, so I better design this code with that future feature in mind...
The disciplined engineer would do that. That is why waterfall exists so ideally the big picture is painted before hand.
The undisciplined engineer will then be frustrated in the future when he has to act like the cool aid man thru the hard pre mature architectural boundaries he created and now needs links or connections that are now needed.
Does moving to agile fix that hell no.. because the undisciplined engineer is still undisciplined.
One could argue the project manager or scrum secretary... (yes scrum secretary I said that right).. is suppose to organize and create and order the features with the future in mind etc...
Bullshit ..soo basically your saying the scrum kid is suppose to be the disciplined engineer to have foresight into realizing future features and making requirements and task now that cover those things? No!
1 scrum bitch focuses too much on pleasing “stake holders” especially taken literally in start ups where the non technical idiots are too involved with the engineering team and the scrum bastard tries to ass kiss and get everything organized and tasks working so the non technical person can see pretty things work.
Scrum master is a gate keeper and is not needed and actually hinders the whole process of making a undisciplined engineer into a disciplined engineer, makes the undisciplined engineer into a “forever” code grunt... filling weekly orders of story points unable to see the forest until it’s over because the forest isn’t show to the grunt only the scrum keeper knows the big picture..... this is bad this is why waterfall is needed.
Waterfall has its own problems, But that’s another story for another day..
ANYWAY... soooo where were we ....
Ahh yess....
Clean code..
Is it a good book, yes.. does uncle bobs personality show thru the book .. yes lol.
If you know uncle bob you will understand what I just did with this post lol. I had to tangent ( at least mine was related to the topic) ...
I agree with the principles of the book, I don’t agree with the extreme view point. It’s like religion there’s the modest folks and then there are the extremists. Well he’s the preacher of the cult and he’s on the extreme side.. but that doesn’t mean he’s wrong.. many things he nails... he just hits the nail thru the wall just a bit.
OOP languages are not the solution... high level languages do not solve everything.. pininciples and concepts can be used across the board and prove valuable.. just don’t hold everything up like the 10 commandments of which you cannot deviate from.. that’s the difference here I think..
Good book, just don’t take it as the Bible as a beginner, actually infact DONT read this book as a beginner. Wait a bit learn then reflect by reading this.
15 -
Right now what i want to do is just quit everything, move somewhere else, get a job and never fucking look back. Im sick of all these projects college dumps on me, the idiots im surronded with, my job, people who think im interested in their fucking research. I just want a 8 to 5 job and after 5 im fucking done and nobody calls me about how long will the next release take for projects i dont give a shit about.
In other news i just started my thesis yay.1 -
Yet another thing i think is fucking stupid.. GDPR btw.
So, a guy in Denmark owns a grocery store and has an issue with people stealing from him a lot the last couple of years. He catches them on tape and shares it on social media to try and prevent it.
Im not sure why it didn't work to go to the cops, but it didn't.
What the owner ended up doing, was hang a note on the front of the store so people could see it before they entered, see attached image.
However, now he has been notified what hes doing is illegal, because the "user" doesn't consent clearly enough.
I dont understand GDPR, but if you do, you're probably gonna find mistakes in what i wrote.
Source for story: https://bt.dk/erhverv/...
Its his fucking store, if people steal from him he should be allowed to post it on pornhub if that was his desire.
It's illegal to kill someone, but if you're threatened on your life, you may kill in selfdefense.
To me, those are the same, just one is on a much more serious level of course.
Fuck me.
13 -
Agencies... Just hate when people are given only time enough for doig crap code, because "there is no budget". Hate even more to work on changes on top of it, because people just dont get why you take so long to do changes that supposed to be simple, ignoring the fact that previously they asked for some slap-dash shit. What do they think, that with time the code cleanup and tidy up itself?
-
So this might be a very long post , but i am sure most of you can relate to it .
So , the year end . Time of joy and appraisals right?You have slogged your ass off the entire year and are expecting amazing ratings.Then boom , your piece of shit sadist manager starts of his review by saying 'there are worrysome things to discuss' after not saying shit for the entire year . I am pretty new to corporate , in fact 1 year old , still managed to handle devops for a team of 130+ , majority of whom have no work apart from playing a blame game and indulging in cheap politics. I mean , bro , I am literally your son's age , i dont see the point in playing this cheap shit with me.On top of that this sadist and borderline piece of shit manager has the audacity to say that I did not raise any blockers , while I have CCed him in every fucking mail possible.How big of an a****** can you be bro?
I counter his points for 40 45 mins straight ,leaving him stuck without words for solid 10 to 15 seconds many times during the 'review meet'. This guy is in the same place working on the same shit code , which 90% of this community can't even think of. Every thing is bloody manual and apparently ' I should have tried to streamline the entire f**** process' . Cool bro , why not open a startup while I am at it ?
Then this piece of poop gives me a rating which is just above the inconsistent performer bracket :) .
I just dont get the points what do these people get by giving shit ratings and not even having valid points to back up their fuck all arguments.This guy , throughout the duration of the call did not say 1 (bloody 1 ) good thing about my efforts. Past context is majority of the smart people who were literally running their pods single handedly , were under him and were fed up with not getting hikes and appraisals.Apart from me ,everyone resigned and left with hikes as high as 50% (LOL right).
But I have a year of experience and its really difficult to perform well in 4 rounds of bs compititive coding rounds, after which I get the generic ' oh you did well bro but we are moving on with other candidates' (FFS) .
I pray that even my worst enemies don't get such managers and I hope he rots in hell.
Amen and sorry for the cussing :) -
I reported to our team leader (who is not a developer) that me and my colleague has been having problems with our senior developer whose codes are unmaintainable and messy. I told the team lead that I am losing my trust towards my senior developer and that his codes are messy and not following the coding standards. I was nervous at first because this certain team leader is tight with the senior dev. But still, I expected the team lead to be objective.
I was surprised because the team lead asked me if 'I was perfect' and then the team lead continued to shift the conversation towards me. Team lead then started to compare me with the senior dev which is unfair because I've only been working for 2 years whereas the senior developer has been doing this for 6+ years. Team lead said that I was arrogant. Team lead sent our convo to the other teammates and friends. Team lead told me that I am such a baby.
Fast forward, the senior dev talked to me. Told me that he was busy so he didn't get to improve his codes. Which I dont buy because I often see his discord status as playing during work hours. Told me that it wasnt him. Which I dont know if i should believe since he always lies. Told me that his knowledge is outdated. Told me that maybe because I came from a good university and he did not. He apologized and told me he will improve. Sounds good right?
It's a lie. Because then my friend gave me a recording of his voice ranting about me after our talk. In that recording, he said that I have nothing to prove so I dont get a say. He said that he doesnt care about me. He said that I am cocky. Which I dont understand. I only commented abt his work, why is he attacking me personally? Plus, if someone new like me already already noticed the flaws in his work, what does that say about his skill?
My teammates then asked me to just take the fall lol take note that these teammates were also complaining about this senior dev. they asked me to just give them what they wanted to hear. That I am the one who's wrong and the bosses are right. I said I wanted to defend myself but they hated me for that. They told me to think about what would happen to them. They told me I am selfish. Is it selfish for wanting to defend myself?
I defended myself. I told the senior dev that my intentions are for the right reason. He told me he understands. Later that day, a friend told me he talked behind my back again.
Senior dev told me that the team leader cried because of the words I said. Which i found confusing because it was my own feeling, my own opinion that i am losing trust with this certain senior dev so why would the team lead be so affected by that? Also, i showed our convo to the most objective people i know and they said that i didnt say anything that is offensive nor arrogant I have no control as to how people would react to the words I say. It's beyond me.
I feel so helpless. I told those things to the team lead because I think a team should be open to each other but I was blown out of proportion instead. My friend told me that the team lead and the senior dev are still talking behind my back.
If they do this every time someone tries to speak up, will they ever grow?24 -
About two weeks ago i posted a rant containing an email from the big boss. Today they held a "virtual town hall" where people could ask questions, get answers, and generally just be online. Went fairly well, good info was handed out, and i think people mostly enjoyed themselves (even if it was at the expense of the higher-ups).
Then comes the email. The same person as last time had this quote:
"I’m good at giving advice, so I need to take some of my own. I intend to take it easy this weekend, watch Netflix, do some household chores, play the piano and maybe even read a book! "
Jesus christ. Remember those memes about zuck being a robot because everything he does it looks and feels like it's an alien trying to blend in? That's what this feels like. On a normal workyear i would hear from this person 10 times TOTAL. I have heard from them this amount in the past 2 WEEKS.
Maybe it's the virus, but this is driving me INSANE. If there's any lesson you can learn from this, it would be:
Dont pretend like you care by not knowing or learning anything about the people you work with.
Jesus they even sent out surveys to see what the telework experience is like... THE RESPONSES ARE RECORDED AND PUBLICLY DISPLAYED!!!
Ugh.1 -
Running my own business is not going well. Hasnt for years now. Previous dev jobs were also just nightmares. I feel like i cant cut it as a freelancer, or as a full time dev. I do enjoy programming but my resume is crap and my worthwhile portfolio items are basically all locked down under NDAs or ambiguous accountability. I cant prove im even worth hiring and im almost too old to be considered for any junior role. Not that i think i could handle it. So im considering finding a new career and keeping coding as my hobby. But first i have to decide what to do about my remaining client. Which is fine because... i dont even know what i could do for a full time job now. Ugh, im so profoundly discouraged i dont even want to try and think about this anymore.
The weekly rant topic indirectly applies here but since its a bunch of self pity i decided it would be best to not tag it such...3 -
So I'm on my morning stroll. Walking, enjoying, watching the world around me.. It's nice how cherries blossom. They smell very tempting to stop there and enjoy the moment. Some flowers under the cherry...
Why do plants blossom again? Oh yeah, that's right, to exchange some speciments in order to grow fruit and seeds. To have their offspring. Just like every other living macroorganism [with a few exceptions ofc]. Life has no other way to survive but to exchange genetic material between two parties and only then trigger growth of the new life.
And that is a very strict rule. No more, no less: it takes exactly 2 organisms to make new life. But why is that? If my memory serves, theory of evolution says that life is like business: cut the losses and let the profits run. Over time it discards everything not required for the organism in order to save energy, and only successful new "investments" remain in the genome. The unsuccessful ones die before they proliferate, so the bad genes shall not survive.
It also says that very simple things, very simple changes lead to very complex outcomes. Us. Life.
But what is simple about life having to need 2 other lives? Exactly 2. It's either simple or efficient, depends on perspective. BUT IT IS NOT BOTH. Look at cells. They just split in half and multiply. Dead simple. It takes one of them to make another one. But with mammals, birds, reptiles, plants and other macroorganisms [excpt fungi] this is not the case! Why?!? I can't think of any scenario where two generic microorganisms, following some dead simple mutations, would come up w/ something that inefficient and overly complex. Like they're living on their own, multiplying by division, and smth very simple happens and they can no longer divide, only mate in pairs. The primitive, efficient and simple mechanism gets terminated and replaced with a different one, incredibly complex one!
Sure, we have protozoa which have similar reproductive mechanisms. They exchange genetic material to multiply.
But look at our, human cells. They dont need that! Look at some reptiles, some plants that only take one to make another. They don't pair as well! It's simple. Efficient. Why do protozoa need 2 for the species to survive?
It's not simple and efficient [tho helps us adapt, but its not my point for now]. See, things like this make ne wonder. What if we, the life, are not as accidental as we think? What if this whole mechanism was set off by someone or something billions of years ago? That's mean there are much older, much more superior cognitive organisms than us. What if protozoa was version 3 of new life [the first two did not survive]? Viruses - v2? Sea creatures - v3, reptiles - v4, and so on until they came up with us, mammals? That'd surely mean we are not alone in this universe. Are they watching us? Will they create a new species any time soon? What's our purpose, are we just an experiment?
And so, from cherry blossoms to existensial dilemma, my stroll is over. Time for breakfast :)1 -
I just want to thank Steam for making steam guard key in all caps. So I dont need to fucking think about if its uppercase i or lowercase L. It would be much better if they do it on all captcha services or just fucking dont use i l o and 0 characters. These are pisses me off. They are so fucking annoying.1
-
Tomorrow i have school starting.
Which inspires me to rant about how school fails. Ill omit the "arguments" - feel free to append arguments for my words in the comments. Lol
Dont get be wrong. I LOVE acquiring knowledge. And this is where my first point starts : PACE. My class is basically an assortiment of dumbfucks who dont understand anything without "learning by heart over the course of several weeks"
Ill give you a concrete example.
Our maths teacher wanted to make us think scientifically. So he invented a new type of numbers "root 6 numbers" that are formed like so:
a + b * sqrt(6)
Now he wants us to find out wether the sum of two root 6 numbers is also a root six number. this is all dandy, BUT CLASSMATES STILL DIDNT GET WHAT ROOT 6 NUMBERS ARE, EVEN AFTER SEVERAL EXPRANATIONS. Worse: they went to the main teacher to blacken the math teacher.
Another example would be the time our class needed to understand functions(x) : 4 weeks. Ik, as a programmer i have some ease, but four weeks is a bit too much.
Because of this slow pace, i am irreversibly bored of and in school.
And this leads to another problem: homework. Since i know most of the stuff (the few things i dont get at school, i research at home) the homework are useless to me and since the others dont get much, the homeworks are often more than abundant {in a negative way}.
So i dont do them - but that makes teachers disregard me. Which im sickened of.
Worse: often i dont get overly good grades (i honestly have no clue why. I know everything and go over most of the stuff with my menthor),which empowers teacher of the argument of "you are not good enuff, so you cant read in class".
It would be JUST FINE if the only problem were teachers - but my peers are horrible too.
I know our brains are growing, but thats no reason for being stupid.
I literally get told that i need to stop wearing shorts because they look horrible.
Yep. Also, most people think they are empowered of teaching me and talking about my defaillance - because they do their homework. Even though they know i know stuff better than them.
Now to one of the worst issues: a group work where we had to de a Radio report. The guy (the one who thinks he is intelligent BECAUSE he has good grades) invited himself and his gf to me, he wanted me to translate 22 pages from german to english (because he was too lazy to write in german), wanted me to do audiorecording, audioediting and writing of a report. When i left the group because i was called "weakest link" he spread the word that i he had done everythinh and that because i left his group had failed (noticed the flow in logic?)
NOW everybody thinks of me as stupid weirdo. And honestly - i think i will stop listening to them. Ive always hated people, i dont need a significant other.
Even though this will come with the secondary effect of me being gossiped at.
But honestly its fine.
You might have noticed my elojquent way of expressing myseld. I did that in order to show that i am, despite my grades, overly proficient in english
Ok. So now comes the conclusion. What should i do? Do you Think that i am like that because im pubescent myself? How can i stop having nightmares of every possible social situotion that could occur?
Does this have to do with me being a dev?
Well. ありがとう for reading.18 -
welcome to devRantRant, where we rant about the types of rants we don't like rather than just ranting about our own lives and experiences
who cares if you dont like a rant? do you REALLY think anyone's gonna care if you rant about not liking it?6 -
I want to rant about tech YouTubers. As one myself, I feel like I do an even exchange with my viewers.
I want your attention, I don't feel like I deserve it, so I teach you something coding related. You get something of value, I get your attention.
But that's not the case with most in this space. Idiots feel like they can spout whatever bullshit they think about.
They're all stupid with their stupid fucking titles and ideas. Let's review some.
Video Title: How much Javascript you should know to get in tech??
Anyone with > 2 braincells: WTF !!!!!
Video Title: How would I start over to learn coding if I could?
My Reaction: Nope, I wouldn't. The things that I did and didn't is exactly what my journey is and I would do it all over again.
And I get the intent, you're trying to put a roadmap for beginners but they're not going to follow exactly how you lay it out. And why are you trying to establish that there is a correct way of learning coding? Everyone learns at different paces at different times. It's a journey not a race.
Video Title: A day in the life of {COMPANY} engineer.
My Reaction: What do you want to show everyone? Your fancy office? Your perks? The job perks which 99% of other devs won't have?
Video Title: How to crack FAANG interviews.
My Reaction: Well, only the top 1% is going to get an interview anyway. You're not acknowledging the fact that the acceptance rate is < 1% in these companies. Creating a video like this creates false expectations in beginner's heads. And they only see these companies as their only shots of making careers. They dont consider startups or starting their own companies.
Video Title: Top 4 dying programming languages.
My Reaction: WTF !!! COBOL was invented in 1959 and there still is demand for it. And my blood started boiling when Tiff in Tech said PHP is a dying language. Like seriously????
Video Title: Top paying programming languages in 2023.
My Reaction: Please, come on. We know it's Java. And 99% of the viewers ain't getting that job. You're just wasting time listing out languages. By the time someone starts from scratch and gets to a position of getting a job, something else will be the new fad.
Video Title: What advice would I give myself when I was starting?
My Reaction: Really? You couldn't think about saying what advice you'd give to your viewers? Are you really that full of narcissism?
There are good techies though, it's just that I get angrier and angrier the more YouTube recommends me these stupid videos. Ah, my chest feels lighter now.6 -
I struggled with weather to post this but I feel like I have to. I didnt want to feed into the fear or give 'them' any more reason to argue against common sense but I guess it cant be helped.
The reason I was gone for a while was because I went and got my vaccination.
In less than half hour after getting the vaccine, I was in the ICU. The staff told me I had a stroke possibly from clotting and inflamation. I couldnt feel my arm or anything below my shoulders. Yes really.
Apparently I "died" for a little while and when they brought me back I was in a coma for almost a week.
I'm back home now and I still dont fully understand what happened. Still have numbness, and horrible headaches, and can barely think straight sometimes, but the doctors told me that I didnt suffer any permanent brain damage according to my scans.
Also they told me I had old damage to my left and right temporal lobe, which makes sense because I have always suffered problems with short term memory and other issues.
And I'm just at a loss how this could happen. I have no serious injuries. We were told this is safe.
And this is the exact reason I didnt want to post it, because now tards will come in and be "lololol serves you right vaxxer!"
If I knew the side effects were this bad maybe I would have changed my mind but no one told me! I mean I think I still would have got it because we have to protect vulnerable people, but still.
The hospital assured me it wasnt the vaccine and must have been an underlaying condition, but I'm not so sure. I just happen to have a pre-existing problem that I dont know about that causes a stroke and paralysis only half an hour after the shot?
And now I dont know if I'll ever be ok. And doctors warned me I may suffer more strokes and to avoid physically demanding tasks for a while. My primary job is construction (not by chooce). Now I face the prospect of not even being able to work my existing job or do the things I love, like hiking, anymore. So much of the world doesnt make any sense right now and I just dont know what to believe anymore.
Tards will probably be in shortly to suggest I check for microchips or test fucking magnets on myself.
No, just stop.8 -
Anybody here know that shitty service called Birthday Reminder? Yeah? Fuck them.
Never signed up for the bullshit, but because some kiddo's I was in class with 10+ years ago (I think it started when i was ~12 yrs old) did, I keep on getting their spam. They have an unsubscribe button in their emails, directing me to a page that says I can only unsubscribe if I log in.
FUCK YOU.
I NEVER SIGNED UP FOR YOUR SHITTY SERVICE AND I REALLY DONT WANT TO DO NOW EITHER.
Ofc I emailed them politely to remove both my email addresses from their databases.
And they are politely ignoring me.
Fuck you.
PS yes I know I can mark them as spam, but I prefer just not receiving their shit at all. I have a very clean spam folder.5 -
My last post was a year ago. What brought me back here is the ability of AI to agree and apologize to anything and everything, while producing the worst hopeful code.
4 days I wasted, trying to make an android audio visualizer, but AI... sigh.
It gave me the wrong structure of FFT bytes emitted. I corrected it
It gave me the wrong logarithm calc, I corrected it
It gave me the wrong sampling rate, I corrected it.
It gave me the wrong texture order, I corrected it.
It gave me the wrong glsl sample2d, I corrected it.
It gave me the wrong textureID generation, I corrected it.
It gave me a render which was about 10 fps, I found out that instead of using native onDraw, I had a fcking delta time in my shader. I almost corrected it, I gave up
Lets go to code generators with Annotations.
Like always, starts very positive, until I start to correct it.
It gave me the wrong file locations, I corrected it.
It gave me the wrong order of find copy modify and write to .build, I didnt correct it.
It gave me regexes to find annotations. Im like So whats the use of an "ANNOTATION PROCESSOR"
It apologizes and used a fucking regex in the processor,..... I didnt correct it, in the end, I was left with a separate module, targetting iOS Android and JVM, with an annotation processor implemented in jvmMain, which tries to modify commonMain src by finding annotations with regexes, which wont run on app build or app sync project, but only on java -jre command pointing to that fucking .java class in that module, which takes at least 2 mins to run, and Finally generate 0 files.
I needed to rant, I understand LLMs are just models of words built and stolen from the most intelligent and dumbest people out there. But Im an idiot for getting my hopes high. I cant build anything new and unheard of. I used to do that. I once made a textView + image print util for a bluetooth printer just to say FU to libraries and heavy sdks. like literally rasterizing shit to bluetooth packets. I needed to let off some steam. I havent been here in a year so I dont know what reactions I can get from this rant. I bet someone will just say yeah we tired of 'Fuck AI' rants. but shit, it hurts. When I gave up on that visualizer, I downloaded an app, I think its called project M, like in reference to MilkDrop.. like the Winamp Milkdrop. I opened it, played something on spotify, and let my eyes go blind5 -
Some bitch posted a story "Fear God and obey God's commandments, because thats the only thing asked from mankind ❤️"
This fucking story fueled me
It enraged me
Blood boil
So fucking much that i had to let this shit out here
First of all, "FEAR God..."
If you fear someone who is supposed to love you, does that look like a healthy relationship to you?
"I love you so much", said the boyfriend to his girlfriend, "but if you dont love me back then I'll set you on fire so you can burn in flames and torment"
In that case do you love him because you genuinely truly love him, or do you HAVE TO love him because of fear from burning alive in fire and torment?
Think about that fucking scenario for a while. Imagine if that scenario happens in our world. The guy would be labeled as a psychopath and get arrested IMMEDIATELY.
But it's completely ok when God does THE EXACT SAME THING, just because hes God?
I'm a christian and even this fucks me up when i think about it. The more logical mind and critical thinking i acquire the more i see through the non logical bullshit.
My faith is shaky.
Im genuinely starting to think over 50% of religious people believe in God not because they genuinely believe, but because of fear of being set on fire and torment forever.
It smells to me like its a fucking MIND CONTROL FEAR DRIVEN CULT.7 -
Dear notebook manufacturers,
do you ever fucking think of how users actually use your notebooks in a company? Almost every company makes use of docking stations. Sooo... Instead of killing my battery over time by being constantly connected to power via the docking station. What do you think of doing some kind of scheduled/more intelligent charging or a charging range? I mean I dont stare 4 hours a day onto my 14 inch notebook display and then think "Oh I need to charge, better use my docking station" and go charging it for 90 minutes whilst staring at two 4k monitors and then unplug everything. My notebook now lives for 20 minutes without a power source... I cant even do proper presentations without using power cable... Please... Do something...
Yeah they will never see this. Just asking myself how you can develop a product do far away from the actual customer20 -
I think i dont have the brain capacity or brain power to process and code extreme complex team WEB projects. Is this normal for WEB development, do i need a lot more practice, more time to understand or am i just fucking dumb for this shit? Honestly
I can code complex mobile apps but i get fucking lost in the middle of coding web projects... Its like im lost in the woods at dark and do not know what to do and where to go.... Literally stuck in one spot, idling.....6 -
URG!
I cannot think about a title, so just story:
in my position as multi headed chimera one of my ongoing task is it to dedust old excel sheets, processes and other super inefficient relics that steal time. Mostly i solve those with some tiny vba scripts, bigger vba scripts or a tiny java applications. usually that takes a few hours or maybe two days, depending on what i think is necessary.
the current task at hand is for our (physical) production, work time is noted on a sheet of paper and later given to the production head. Who then proceeds to type it all in excel to do his thing. The guy is starved of time by a huuge margin.
So, crafty kangaroo that i am i think: a barcode scanner, some raspberry pis with touchscreens and some mediocre php/mysql/javascript will make our worries go away. of course this will be a longer task but there is no need to have it done immidiatly. So crafted a working prototype, presented it in the weekly company meeting and got it "greenlighted".
The other day our CEO-like guy was ranting that nothing in this company gets ever done and that people wasting their time with useless projects and named my project among them.
I dont get humans. First he gives thumbs up for this, knowing that it will probably take me 100 hours or so to create in a working manner but later he calls it "a waste of time?" I presented the use (reducing expensive mantime, paper waste and room for fudgery) and yet he calls it useless? (well, his point was that there are other problems (which are out of my reach anyway))
they guy normally is pretty nice and has an ear for problems, but when it comes to higher computer stuff (>excel) he really struggles.
:/
i really like my side project, gives me room to flex some muscles and test stuff. Also playing with raspberry pis on worktime.
On a sidenote, anyone ever tried raspi mesh networks and knows where i get working >10 inch capacitive touch screens? -
I'm literally in pain right now and not a thing I can do.
If I eat whatever the fuck is wrong with my jaw (cracked tooth or cavity) starts throbbing from the chewing action, in addition to coming on for no reason at all. vision-blurred-waves-of-nausea levels of pain. Enough that I'm alternating between laughter and almost tears.
I've downed four aspirin and it's still just barely enough WITH the numbing gel.
Got lock jaw something aweful.
Barely convinced a dentists office, which is supposed to be closed (and cancelled all it's appointments due to corona), to come in during quarantine. But thats monday. Dont kno how I'll make it. They do payment plans but I'm flat broke because I decided to pursue programming right when all this fucking bullshit went down.
And all I can think of while im typing this is the pain.
And fuck me I cant do weed because my backup plan if I fail at coding is the military.
And this stray dog that the neighbors 'adopted' but leave outside WONT STOP FUCKING BARKING.
Fuck me. Just kill me now. Do it.
Gonna go watch comedy because I read a research paper that says genuine laughter raises pain threshold by up to 10%.12 -
Data wrangling is messy
I'm doing the vegetation maps for the game today, maybe rivers if it all goes smoothly.
I could probably do it by hand, but theres something like 60-70 ecoregions to chart,
each with their own species, both fauna and flora. And each has an elevation range its
found at in real life, so I want to use the heightmap to dictate that. Who has time for that? It's a lot of manual work.
And the night prior I'm thinking "oh this will be easy."
yeah, no.
(Also why does Devrant have to mangle my line breaks? -_-)
Laid out the requirements, how I could go about it, and the more I look the more involved
it gets.
So what I think I'll do is automate it. I already automated some of the map extraction, so
I don't see why I shouldn't just go the distance.
Also it means, later on, when I have access to better, higher resolution geographic data, updating it will be a smoother process. And even though I'm only interested in flora at the moment, theres no reason I can't reuse the same system to extract fauna information.
Of course in-game design there are some things you'll want to fudge. When the players are exploring outside the rockies in a mountainous area, maybe I still want to spawn the occasional mountain lion as a mid-tier enemy, even though our survivor might be outside the cats natural habitat. This could even be the prelude to a task you have to do, go take care of a dangerous
creature outside its normal hunting range. And who knows why it is there? Wild fire? Hunted by something *more* dangerous? Poaching? Maybe a nuke plant exploded and drove all the wildlife from an adjoining region?
who knows.
Having the extraction mostly automated goes a long way to updating those lists down the road.
But for now, flora.
For deciding plants and other features of the terrain what I can do is:
* rewrite pixeltile to take file names as input,
* along with a series of colors as a key (which are put into a SET to check each pixel against)
* input each region, one at a time, as the key, and the heightmap as the source image
* output only the region in the heightmap that corresponds to the ecoregion in the key.
* write a function to extract the palette from the outputted heightmap. (is this really needed?)
* arrange colors on the bottom or side of the image by hand, along with (in text) the elevation in feet for reference.
For automating this entire process I can go one step further:
* Do this entire process with the key colors I already snagged by hand, outputting region IDs as the file names.
* setup selenium
* selenium opens a link related to each elevation-map of a specific biome, and saves the text links
(so I dont have to hand-open them)
* I'll save the species and text by hand (assuming elevation data isn't listed)
* once I have a list of species and other details, to save them to csv, or json, or another format
* I save the list of species as csv or json or another format.
* then selenium opens this list, opens wikipedia for each, one at a time, and searches the text for elevation
* selenium saves out the species name (or an "unknown") for the species, and elevation, to a text file, along with the biome ID, and maybe the elevation code (from the heightmap) as a number or a color (probably a number, simplifies changing the heightmap later on)
Having done all this, I can start to assign species types, specific world tiles. The outputs for each region act as reference.
The only problem with the existing biome map (you can see it below, its ugly) is that it has a lot of "inbetween" colors. Theres a few things I can do here. I can treat those as a "mixing" between regions, dictating the chance of one biome's plants or the other's spawning. This seems a little complicated and dependent on a scraped together standard rather than actual data. So I'm thinking instead what I'll do is I'll implement biome transitions in code, which makes more sense, and decouples it from relying on the underlaying data. also prevents species and terrain from generating in say, towns on the borders of region, where certain plants or terrain features would be unnatural. Part of what makes an ecoregion unique is that geography has lead to relative isolation and evolutionary development of each region (usually thanks to mountains, rivers, and large impassible expanses like deserts).
Maybe I'll stuff it all into a giant bson file or maybe sqlite. Don't know yet.
As an entry level programmer I may not know what I'm doing, and I may be supposed to be looking for a job, but that won't stop me from procrastinating.
Data wrangling is fun.
1 -
NO! Use the description instead of the primary key because the key might change ................................................................................................................... vs the description .............................................................................................................. the key more likely .............................................. meh1
-
Okay so Im just stuck. Ive not programmed in a few weeks I wanna say, and when I do I go on the binge and then I "take breaks" to relieve the stress because I want to just relax but I dont force programming out of my life I also think about better ways to do stuff but I feel like shit because I want to just enjoy and relax with some games but I enjoy and LOVE programming but I just dont know what to do. because I want to enjoy some of the games I got for christmas but I want to keep improving and I feel if I go a day without it just that much shittier for not. and I cant see how much Ive improved. I just cant relax and feel good about it.
-
I just got scammed in web3. Again. Luckily by following an extremely strict risk management i lost $25.
But apparently now i have to be even more strict and be rigorous to the extremes.
"Pay me up front payment and ill start" Fuck you. Fuck all of you requesting for an upfront payment.
Do you think in the real world when you get hired at ANY job, do you think you're paid up front even a fucking dime? NO. You start working and get paid 1 whole ass Fucking month LATER. But only in web3 do these shitholes ask for an "uP fRoNt pAyMenT s0 i cAn StaRt wOrkiNg". No. Fuck you. I hope you get a fucking cancer and choke on a dead ape's dick.
How Fucking PATHETIC does your poor miserable waste of life have to be to scam someone for just $25? What the fuck?
Web3 is FULL, actually full is a compliment so I'll say it this way: Web3 is OVERLOADED AND OVERFILLED WITH FUCKING SCAMMERS. They're dripping EVERYWHERE. DMs. Discord. Twitter. Fake profiles. Fake messages. Fake cloned websites. Fake scam influencers. Fake marketers. Fake collab managers. Lies deception and exaggeration of results. Or even if it's the original collection, it's probably still a scam.
I don't know what to fucking do no more.
OH have i mentioned Web3 influencers? Oh my fucking god. These influencers on twitter for web3 are the most narcissistic, egocentric, arrogant, RUDE and EXTREMELY disrespectful as fucking pricks they are. I can not lead a normal conversation with ANY of them without them offending me because i dont want to give them my hard earned money right away. Fuck you. FUCK YOU. I HOPE YOUR WHOLE FAMILY DIES IN CAR CRASH FUCKING LOSERS.
Instead of focusing on building in web3 and developing software im now stressing 90% of the time about potential scammers and focus on being careful not to get scammed......
The amount of TOXICITY in Web3 is EXTREME. This is so Fucking ANNOYING and mentally EXHAUSTING21 -
Let me rant! I don’t usually do this but this is just frustrating and draining. Please tell me if im wrong. We have authentication that needs to be refactored. I was assigned on this issue. Im a junior btw. I also attached an image of my proposals. The issue of the old way of our signup process is that when validation fails they will keep on accepting the TaC (terms and conditions) and on our create method we have the validation and creating the user. Basically if User.create(user_params) create else throw invalid end. (Imma take a photo later and show it you)which needs to be refactored. So I created a proposal 1. On my first proposal I could create a middleware to check if the body is correct or valid if its valid show the TaCs and if they accept thats the moment the user is created. There is also additional delete user because DoE told me that we dont need middlewares we have before and after hooks! (I wanted to puke here clearly he doesn’t understand the request and response cycle and separation of concerns) anyway, so if middleware is not accepted then i have to delete the user if they dont accept the TaCs. Proposal 2. If they dont want me to touch the create method i could just show the TaCs and if they dont accept then redirect if they do then show form and do the sign process.
This whats weird (weird because he has a lot of experience and has master or phd) he proposes to create a method called validate (this method is in the same controller as the create, i think hes thinking about hooks) call it first and if it fails then response with error and dont save user, heres the a weird part again he wants me to manually check on each entity. Like User.find_by_email(bs@g.com) something like that and on my mind wtf. Isnt it the same as User.create(user_params) because this will return false if paras are invalid?? (I might be wrong here)
This is not the first time though He proposes solutions that are complex, inefficient, unmaintainable. And i think he doesnt understand ruby on rails or webdev in particular. This the first time i complained or I never complained because im thinking im just a junior and he hs more experience and has a higher degree. This is mot the case here though. I guess not all person who has a higher degree are right. To all self thought and bachelors im telling you not all people who went to prestige university and has a higher degree are correct and right all the time. Anyway ill continue later and do what he says. Let me know if im wrong please. Thanks
4 -
Im beginning to think im stuck in an infinite loop of learning. This fucking bullshit never stops. I just continuously keep learning new shit and the more shit i learn the more i realize how much bullshit i still have to learn
It creates an illusion as if i know nothing
Just when i thought i see the end of the horizon and reach it only then i realize it just keeps on going into oblivion, as a sphere
Its like im trying to catch and find a corner of a sphere
There aint none
Its pointless
Is it also pointless to keep learning like this?
Perhaps this whole existence is pointless
Real talk now whats the point of existence bro
No matter what you do or dont do it doesnt matter
No matter if you're successful or not it doesnt matter
No matter if you learn all the bullshit in the world you're still gonna die and it wont matter
No matter how much i learn, it still and will always appear as if its not enough to these shitface recruiters and companies, to them it doesnt matter
Nothing matters. Everything is empty and meaningless. The entire life itself is. I dont value life. I dont care if i live or die. I feel no joy when i succeed and i feel no sadness when i fail
The tiny little bit of joy or success cannot outweight the years of sadness depression emptiness and failure the life has dumped onto me in spite of my hard work and continuous learning
Hhhhhhhhhhhhhhhhhh15 -
After redhats totally dick move, who would actually stay with openshift paas? Theyll just take v2 down with a month notice and think no one is affected. They could do that to v3 too one day, they clearly dont think about the customers. I guess openshift isnt for production after all, only for fun.10
-
Hey,
I studied law first and got a retraining about Java from my company for 6 months (just very basic concepts about servers, databse,.. besides java). I really enjoy programming now and that is what I want to do. Do you guys think I need to study computer science to become a good programmer or to change my employer (payment here is really moderate ~ 30k € max ,after taxes, but safe work and good payment after retirement) ? Is there any international certification that should be enough ? Just dont know if it could be a waste of time, becouse I am at a spot to just get practical experience.
Any opinions of you pros ?
Big thanks in advance :)4 -
!rant
I've been coding for just about 2 months now! I literally dont wanna do anything else!! Its all I can think about... I know im not qualified to work a dev job yet lol but I wish i could nab a junior dev position so I can practice 9-5 not just after business hours and on the weekend... -
This is an actual transcript...
Since it's way too long for the normal 5000 characters, hence splitting it up...
Infra Guy: mr Dev, could you please give some rational for update of jjb?
Dev: sparse checkout support is missing
Infra Guy: is this support mandatory to achive whatever you trying to do?
Dev: yes
Infra Guy: u trying to get set of specific folder for set of specific components?
Dev: yes
Infra Guy: bash script with cp or mv will not work for you?
Dev: no
Infra Guy: ?
Dev: when you have already present functionality why reinvent the wheel
Dev: jenkins has support for it
Dev: the jjb is the bottle neck
Infra Guy: getting this functionality onto our infra would have some implications
Dev: why should I write bash script if jenkins allows me to do that
Dev: what implications ??
Infra Guy: will you commit to solve all the issues caused by new jjb?
Dev: you show me the implications first
Infra Guy: like a year ago i have tried to get new jjb <commit_url>
Infra Guy: no, the implications is a grey area
Infra Guy: i cant show all of them and they may hit like in week or eve month
Dev: then why was it not tackled
Dev: and why was it kept like that
Infra Guy: few jobs got broken on something
Dev: it will crop up some time later
Dev: if jobs get broken because of syntax
Dev: then jobs can be fixed
Dev: is it not ???
Infra Guy: ofc
Infra Guy: its just a question who will fix them
Dev: follow the syntax and follow the guidelines
Dev: put up a test server and try and lets see
Dev: you have a dev server
Dev: why not try on that one and see what all jobs fails
Dev: and why they fail
Dev: rather than saying it will fail and who will fix
Dev: let them fail and then lets find why
Dev: I manually define a job
Dev: I get it done
Infra Guy: i dont think we have test server which have the same workload and same attention as our prod
Dev: unless you test how would you know ??
Dev: and just saying that it broke one with a version hence I wont do it
Infra Guy: and im not sure if thats fair for us to deal with implication of upgrading of the major components just cause bash script is not good enough for u
Dev: its pretty bad
Infra Guy: i do agree
Infra TL Guy: Dev, what Infra Guy is saying is that its not possible to upgrade without downtime
Infra Guy: no
Dev: how long a downtime are we looking at ??
Infra Guy: im saying that after this upgrade we will have deal with consequences for long time
Infra Guy-2: No this is not testing the upgrade is the huge effort as we dont have dev resources to handle each job to run
Dev: if your jjb compiles all the yaml without error
Dev: I am not sure what consequences are we talking of
Infra Guy: so you think there will be no consequences, right?
Dev: unless you take the plunge will you know ??
Dev: you have a dev server running at port 9000
Infra Guy: this servers runs nothing
Dev: that is good
Dev: there you can take the risk
Infra Guy: and the fack we have managed to put something onto api doesnt mean it works
Dev: what API ?
Infra Guy: jenkins api
Infra Guy: hmmm
Dev: what have you put on Jenkins API ??
Infra Guy: (
Dev: jjb is a CLI
Infra Guy: ((
Dev: is what I understand
Dev: not a Jenkins API
Infra Guy: (((
Dev: (((((
Infra Guy: jjb build xmls and push them onto api
Infra Guy: and its doent matter
Dev: so you mean to say upgrading a CLI is goig to upgrade your core jenkisn API
Dev: give me a break
Infra Guy: the matter is that even if have managed to build something and put it onto api
Infra Guy: doesnt mean it will work
Dev: the API consumes the xml file and creates a job
Infra Guy: right
Dev: if it confirms to the options which it understands
Dev: then everything will work
Dev: I am actually not getting your point Infra Guy
Infra Guy: i do agree mr Dev
Dev: we are beating around the bush
Infra Guy: just want to be sure that if this upgrade will break something
Infra Guy: we will have a person who will fix it
Dev: that is what CICD is supposed to let me know with valid reasons
Dev: why can't that upgrade be done
Infra Guy: it can be done
Infra Guy: i even have commit in place3 -
7:45 am
get broken by alarm #1, fall asleep
7:50 am
get broken by alarm #2, fall asleep
7:55 am
get broken by alarm #3, fall asleep
8:00 am
get broken by alarm #4, fall asleep
8:10 am
get broken by alarm #5, fall asleep
8:20 am
get broken by alarm #6, fall asleep
8:30 am
get broken by alarm #7, get up
8:35 am
Prepare for work
8:40 am
Go to office job
9:00 am
Slave for $8.125 an hour matrix job
5:10 pm
Come back home, hungry, exhausted
5:50 pm
Finished eating, take a break
6:10 pm
Finished taking a break, time to start working on my side project
8:00 pm
Feeling exhaustion and stunned, as if i got hit by a flashbang grenade
9:00 pm
Exhaustion exponentially increased. Yawning. Eyes barely open. Extreme tiredness. Head movement started producing motion blur. Body just wants to shut down and sleep
10:00 pm
Start losing concentration while coding my side project. Start making stupid beginner bugs that i fail to debug
11:00pm
By this time i am barely functional so i have to go to bed. Sleep and repeat all of this bullshit every day
---
Is....this...the life thats awaiting me for the rest of my life if i dont earn millions asap? If so then i dont want it. I reject this type of life like satan rejects cross. I do not want to be a part of this clownery.
REALISTICALLY getting 2 hours per day of optimized time and energy to work on my project, is not enough. Even 8 hours a day is not enough. I need full time work on my project. Thats how valuable it is.
This job is draining me. I feel like i signed a contract with the devil to drain my soul. Fuck. Seems like all contracts we sign is the same shit as selling our soul for money? WTF think about this bullshit! Celebrities seem to be the smartest then. They sign contracts to perform satan rituals in exchange for MILLIONS of dollars while we sign a contract to work for satan and get paid $8.125 an hour like fucking losers.
I cant believe nobody warned me about this satanic society since i was a little kid12 -
I think I am going through burnout.
How do I deal with it?
Joined a startup with crazy work culture in Jan.
Have been working 14 hours a day for months starting march 2020, and even that was only to barely keep up with my colleagues. I have been one of the top performer in my previous jobs.
since the beginning, It always bothered me seeing people working on weekends, and falling behind if I didnt, to not have time for anything else, but I started really hating it a couple of months back.
Work has slowed down a bit now, but I just can't do it. Cant focus and get even basic tasks done. Still getting by with last minute efforts but I hate it!
Dont have the guts to leave the job, but also realise I am not doing enough and will get kicked out eventually anyway.
What can I do, to get over this?15 -
Just finished coding/support/putting fires down marathon that lasted 2 weeks.
Basically I launched 2 gaming servers got around 600 online players and had to spend 2 weeks around 12 hours everyday supporting them doing hotfixes and etc. I had no time for life. Ioved the work, debugging, responsibility and making impact. Also made some money.
Now I feel completely drained, sick and tired. I think I hit a burnout. I thought I will enjoy my time off with my gf but I just wanna lie in bed and dont do shit for at least 2-3 days. Extended stress over time did a number on me, I am now a nervous wreck.
How can I bounce back asap after a burnout? I have 2 weeks to rest and will have to launch 2 projects again and deal with christmas/new year bullshit...1 -
First time linux user feedback
Linux lovers are probably gonna eat me alive but I don't give a flying fuck
Maybe its a little lenghty or boring, tell me what you think
Backstory:
I work for game extension company. We work with WinAPI and such. I've been using Windows since forever and I'm happy with it. But I thought to myself "hey, if I wanna be a good dev, I should give Linux and OS X a try, too"
I downloaded Linux Mint couple of months ago to start with. I was unable to boot it from live CD no matter what I tried, even in recovery mode. Apparently, Mint 18.3 was based on Ubuntu 16.04 which doesnt support UEFI
Wait, what the fuck, all modern PCs have UEFI so what, do all Mint users have 10 y/o laptops and PCs???
Anyway, when I heard about Mint 19 being released I thought to give it another try and I did. What a surprise, it booted successfully from Live CD. I saw the Linux desktop for the first time in my life, yay! I then installed it, GRUB appeared, my Windows was still there and wasn't broken so I was happy SOMETHING was working. I configured timeshift and applied dvorak layout system-wide. Realised dvorak layout is fucked up big time and applied normal layout for just desktop environment. Everything was really nice until couple reboots later Cinnamon stopped launching (kept returning to login screen). Okay, lets use timeshift
First big what-the-fuck was when I found out system restore can only be done using GUI??? This is absolutely retarded and I couldn't believe it is true. Login screen has a reachable console but I can't login there since I can't type the password. Fuck, fuck, fucking drovak layout was there.
Recovery mode - I've spent 20 minutes trying to type "timeshift --restore" having to press all keyboard buttons just to progress with one button. I've had another what-the-fuck when I saw "error: can't restore timeshift - partition already mounted"
Okay, this is too much. Why the fuck would you bundle a recovery mode if you can't restore a snapshot from there.
I have spent 3 hours now googling and trying to remove this fucking keyboard layout. No dice. I am making another copy of the live CD now. I'm gonna reinstall the whole shit now. I have the desire to create a custom Mint version without this abomination of a keyboard layout.
It's okay. Windows has taught me to be patient.
Fuck Dvorak, I dont know who the guy is but his keyboard layout can eat my dick7 -
First post and of course it's a rant.
I work for a mid sized development agency with approx 50 developers heading up the main development backend team.
So, on this one project the head of design goes through the client agreed spec but starts adding loads off additional UI elements and data that isn't in the spec, isn't collected anywhere and isn't needed
When reviewing the mock ups I raise this and push back saying it all needs to be taken out as we dont have that data and that the additional elements are not recoverable in the sprint time.
Designer sends the mockups to the client anyway and gets sign off from the client, who now expects all this additional work in the same sprint and at no extra cost to what we agreed for the sprint.
After an aggravating day trying to figure wtf we are going to do, I end up working until 3am (having started at 8am the previous day) implementing the addition shit, which needed to be collected and surfaced throughout the entire back end.
Owner of the business walks in this morning and gets told by the management team about how late I was working and what had gone on.
His response........
Pay for all employees in the business to have a takeout lunch on the company.
Best of it all, I was so busy catching up on the shit I should have been doing, that I didnt even get my free food!!!!
Why do designers think everything is so simple and just takes a few key presses?!?1 -
This is kind of a loaded question because it's so broad. So I'll just throw my thoughts down on the idea anyways.
Honestly with all the way that game dev has come it's so sad to see just the increase of people that are so ungrateful and dont appreciate what went into making it. Complaining about small not a big deal bugs that occur, blaming the devs for stuff that's completely not up to them but the "idea man", etc. Although good things are coming out of it. Like children wanting to get into it more which is awesome and indie developers basically holding up the industry while majority of the AAA companies get their shit together. So I see all of that increasing. Also I'm expecting to see the Rust language start to be used in AAA titles replacing C++
Web dev I believe will just get more JavaScript improvement with new libraries, frameworks. I really hope the companies that had PHP5 legacy code get back on their feet quickly. But I hope we can become more accepting of JavaScript doing more than just webdev like Electron, WebGL, etc. Because I think it's great that it can do all that stuff. Is there better options hell yeah but let's let people do crazy shit.
Software dev well I see python making a bigger uprising and I'm hoping people become more accepting of python as well.
These are all just random thoughts so please take that into consideration -
I feel like such an idiot every time I use windows just slightly beyond clicking buttons. I'm trying to write a very simple macro to simply send an email out when I receive an email with a particular header. and no, outlook doesnt support that with rules. so now I have to use this garbage IDE, writing a script in a 25 year old language, with every bell and whistle button you could possibly think of and no way of figuring out how to do anything without being balls deep in a decade old forum post. I hate microsoft more and more every time I use it. I thought maybe if I got good and started "dev"ing with it more, I'd hate it less, but no... its always some super clunky application with shit tons of buttons and you dont know what they do, and when the app breaks, it gives you some hex number and nothing else, and sends all the good stuff to microsoft so they can fix it in the next "big update" thatll fuck up youre entire days worth of work and kill an hour of your precious time. Ugh.1
-
This is probably the worst place to start my Rant saga but this is recent (this is one of the last few episodes of a 3 series cluster fuck of a job so you're missing out on all the straws that go into breaking the camels back and making him unaccommodating)
TL;DR I do good work, management dont like me and go out their way to try and fuck up my days
So, lets start, I'm a contractor, got funeral Tuesday, book leave, book WFH for day after.
I leave in 3 weeks, woman who is the CIO's right hand bitch takes me into a room the next day or so in the morning to discuss my WFH day. Leave on tuesday is cool but this WFH day...there's only so long until I'm gone so they want me to stay in for more face-to-face time blah blah blah (considering this woman isn't even part of the project I'm working on anymore because she decided to deflect it onto a underqualified junior with no PM experience)
So I sit there, thinking of all the blood and sweat that I have shed, the mountains I've moved just to be told to move the mountain somewhere else and whether coming in would kill me (in other words im fucking burnt out!!! I have built their GDPR database and app backend single-handedly with no requirements, project managers who can't plan and being chastised for asking for documentation/plan/anything written down and having the CIO who is also the fucking DPO ignore any emails/slack I send him relating to the project and having to keep up with a team of devs....).
So because there was a momentary silence, she decided to fill the gap
"Oh, you've done some good work so far and I wouldn't want you to ruin it all in these last 3 weeks. So just come in on the Wednesday so that we can have you here."
Hmm....yeah...i didn't notice what she had ACTUALLY said there, still thinking about can i be fucked? So she decides to add
"...there's only 3 weeks left, wouldn't want you to burn any bridges. Remember, we still have to give you a reference"
....Okay....shots fired. So i respond
"You saying, if I take a WFH day, you'll give me a bad reference?"
"Noooo no no no, not saying that, just that you've done good work and we wouldn't want you to ruin it"
"With one wfh day?"
"We just want you to come in because the developers might be coming here that week"
"Oh... I hear that...what day?"
"I dunno, it's not been booked yet"
".............................I'll think about it"
"There's nothing to consider"
*Start leaving room* "I'll think about it...."
So cool, obviously, had a think, decide to shoot over an email (or more accurately, a collection of bullets). Which basically said, in devRant translation, "Fuck y'all, I'm WFH on that day, I wish a motherfucker would fuck up my reference, we can go that way if you want it. *snaps fingers* I. WISH. YOU. WOULD! "
Woman says "I wasn't threatening you, was just saying...dont ruin your last 3 weeks, wouldn't want you to burn any bridges and that we still have to give you a reference"
What kind of Godfather comment is that?
Come in today, the CIO, who is a prick who don't like me for whatever reason, sends me long email trying to disrespect me and in the midst says "I’m sorry that you have chosen to react like this, I’m sure that [my bitch] was conveying a position that your last three weeks of contract are crucial for a smooth handover. I have made the decision to not require you to work from home on Wednesday. I understand you are on leave on Tuesday and therefore this is now extended to include Wednesday. I look forward to seeing you back in the office on Thursday. I hope this will make the situation better for all parties."
.................................thought you lot needed me in the office to ensure a smooth handover................logic..........people.............where the fuck do you get yours from!?!?!?!? All this just so they can say "We made the decision at the end :cool:" -
Well Django, I think I've fucking HAD IT WITH YOUR STUPID FUCKING SHIT ALREADY.
./manage.py shell
In [1]: from inventory.models import ProductLine
In [2]: ProductLine
Out[2]: inventory.models.ProductLine
In [3]: ProductLine.objects
Out[3]: <django.db.models.manager.Manager at 0x7f03e23017b8>
SO WHY IN THE FUCKING FUCK DO I GET
"""
, in ProductLineViewSet
queryset = ProductLine.objects.all()
AttributeError: type object 'ProductLine' has no attribute 'objects'
"""
FUCK ME
I hope I just FORGET I am a programmer, wake up tomorrow free to go work at fucking McDonalds and die in mediocritity anyway. FIANLYL Get to catch up on fucking work and I have to diagnose this inane fuckign django model problem that I dont fucking see anywhere on google, SO, etc right now
Best I can find are all like "You've probably defined something else called <model class name> in that file." But Grep and I sure as fucking tits can't find it!!!!!
Time to fucking make an exact copy of everything but change it to ProductLine2 and watch it all work perfectly fucking hell am I really this stupid or am I going to eventually find a bug after hours of GETTING FUCKING NO WHERE OMN THE STRUPIDEST FUCKING SHUIT IVE EVER SEEN FUCK ME7 -
I have an idea of starting my own business and I need your feedback guys. Literally appreciate any kind of feedback.
So Im an android dev who has 3 years experience under his belt. I am working fulltime and I think its time to scale. I want to open my own agency where I would take on big clients and build apps for them. I personally am able to manage/see through the whole project, handle all communication and also work on the android side if necessary. I would start from smaller projects worth of 30-40k for startups, basically create MVP for them and charge for support after that.
Problem is that as far as I understand if you want to "open your own kitchen" you need to be well connected. I dont know any big clients who would trust and purchase my services, because after all who I am? Im nobody just a dev at this moment. So I need a strategy to build some relationships with businesses.
So Im thinking long game. What if I would first open a recruitment/hiring agency? I would focus in specifically mobile dev recruitment. I have the soft skills and I already participated in dozens of recruitment processes. I also have the tech skills, I would be a competent recruiter. Maybe I could do that for a year, just communicate between devs and clients and place devs. My thinking is that in around one year I would be able to build a massive network of clients and devs.
And then, I could try opening my own dev agency. Using my gathered contacts hopefully I could land some decent projects for start and build my team or outsource from that point on.
Ofcourse Im not sure if I could pull this off alone, I would need a detailed strategy and some mentoring. But what do you think is this a viable plan?2 -
Okay so im gonna get some confused and many disagreeing ranters on this.
I like SoloLearn. I said it.
I think its a good platform to learn the syntax for a language. and get basic understanding on the language. granted It does a horrible job at teaching you what or how to do things. and its webapp isnt nearly as great as the mobile app.
the mobile app has a lot more "lessons" ranging from ES6, Angular, React, Algorithms, Cryptography. they obviously arent the best. and SoloLearn has SO many flaws and I understand that, trust me I understand more than anyone
I just dont think its the worst.3 -
Okay, my first serious rant.
An acquaintance of mine when needed my help always explain his problem equivocally. Like, he would explain laboriously of the method to achieve what he needed when the thing he only needed is just a simple API call. Im not saying im an expert in this area but his explanation doesnt help me to understand his problem. If i do not understand his problem, how can i help him? At least if i know what his problem is and i cant help, i can seek help from others.
And hes not even working in the same company as me. And he wants it solved ASAP. I dont know your problem, yet you want me to solve it? I dont even know if im capable of solving it! And I have my own job to do..
He always try hard to explain it. He tried to sound professional. And he always ask for my help first because I knew he doesnt want others to know that he doesnt know how to code. Why do you apply for the position if you know you cant handle it?! Everytime. He's been fired before. And he did it again. I cant. We are fresh graduate. Apply for a fresh grad position. If you dont know anything, just said you dont know unless youre very quick to learn..
I remember once we need to submit a linux commands or something homework. We need to code it during the class and submit it by the end of the class. He asked me to code for him while mine is still half done. "Quicker please!" he remarked. There were still plenty of our classmates still doing it and some even havent done it yet. What the f are you rushing i felt like slapping him in the face with the keyboard at that time but because i am a matured adult i did not do it.
Hes not even a bully he just always get panic without reasons. He wants things done early and then he can post on social media. "Oh so tired this program is so complicated" or like "Oh damn, they want me to lead the group again (roll eyes emoticon)"...
Please somebody run over him.
Hes making me bald everyday and i think this is unhealthy. If he wants to get bald, get bald alone. I was just starting to work but my hair has been falling everyday.5 -
Okay so I have been thinking about transferring to linux. But I'm not too sure because of a few things I'm hoping yall can explain to me.
1st problem.) The operating system just feels so empty
2nd.) Theres a lot of customizing I would have to go through (which isnt really a problem it's just difficult getting it to look good)
3rd.) I'd have to learn to use the terminal more (which might be easier than I'm thinking)
4th and final.) I dont think I'd be able to use C# I know .NETCore is a thing but I dont think I'd be able to do as much with it.
I know these would probably go away after awhile but I've tried using it before but im afraid of making it my main OS I'm also putting aside games in my problems cause I know they recently made gaming better on linux I just dont know the extent to that.
Any help is appreciated and please go easy on me 😅12 -
Oh my... I'm so exhausted and tired of everything. First I got really sick for two weeks and couldn't work. I also collapsed on the floor one night and hurt myself. Well what happens yesterday? You guessed it - I fell down the stairs and hurt exactly the same spots as two weeks ago... (no I was not drunk).
And then I have to work on a holiday today (yes, still with that same fucking shitty shopware project) because I have to attend an appointment in a different country on Thursday (I need Thursday off, but I don't have any vacation left).
So here I'm sitting almost crying in pain because of this FUCKING project, everything hurts, I still can't think straight and shopware is denying my refresh tokens. FUCK THIS JOB. Seriously. Fuck it. I have had the chance to look into a lot of companies and do different things, but this is the worst.
Nobody fucking cared about the project for nearly 8 months, and now that I'm close to leaving the company they begin to act like "oh well it must be done by then". ARE YOU FUCKING KIDDING ME?! I told them a million times I need help and that I won't be able to finish it in time. That's what happens when nobody plans a project, but accepts it anyways because "it brings in money".
Seriously?! This project has been a waste of money and my energy and nerves. We're already 100% over the budget and will never ever see one cent coming from this shitty project. WHY FOR FUCKS SAKE IS IT THAT THOSE PEOPLE JUST DONT SEE IT WHEN A PROJECT IS GOING DOWN THE FUCKING DRAIN?!3 -
Do you think is it worth buying macbook air or some other laptop for the same price? I know I can get better specs for that money but I dont game or do a lot of video editing so I Don't need a beast graphic card, I just need it for coding. What do you think?5
-
Men fo real! I dont rant so much because I think its a negative attitude but let me do it anyway! Listen. My boss boss told me to create a dynamic drop which I did. A backend request then display it on the frontend which is easy, then on code review he ask why do we need this error handling. Bruh as soon as I heard that question, I got covid. Bitch we do need that error handling because if theres error on requests it will set to default options, but I didn’t say anything tho. I just ask what will happen if there’s an error?, he said I don’t think a simple request will respond error if you did it right. Then I agreed and remove the code. Hot damn! Mind you guys. When they started the app there are no test code. 0, nada, nothing inside the spec folder.7
-
Maybe you people will like this story.
The past semester I studied Java in class. First time doing object oriented programming, I had an annoying teacher but got the hang of it. I still miss C from the last year.
As a final project we had to do any program and apply some stuff we saw in class (The program should have an array list, use interfaces, bla bla bla bery simple stuff). It also must have a complete documentation, a manual and a diary explaining what was developed every week. Bonus points if it was in a repository like GitLab.
I wanted to do an RPG game in a matrix, like a rougelike or an old FF game, that should be a map or two, a few monsters and items and that's it. Enough to show what can I do and to have enough excuses to apply everything that the teacher asked. I had a team with two friends who wanted to do the same.
After making accounts in three different pages that apparently would help us to be more organized (One to make charts and two task trackers) I lost all patience and made an account in GitLab, made the basic classes that we had defined in a chart, divided the tasks and put them in to do on GitLab and we started to work.
One of my companions caused a lot of problems. First, he didin't wanted to learn how to use GitLab (I simply asked them to do merge requests) and he insisted to use GitHub. Then he started to say that using the console version was even better (Pretty sure he said thet he never used Git, but maybe was gas poisoning). The GitLab repository never had a single commit to his name.
BUT WAIT IT GETS BETTER all the entire time, he was complaining about the graphical interface of the game, wanting to use some SDK for RPGs that he found. I told him that we will see that at the end, that first we should have all the mechanics done, test it in ASCII in the console and then, if we have time, we will put the visual interface, separated and optional from the main program to avoid problems.
After two weeks where he gave me very simple standard stuff late, half done and through Google Drive, I discovered he was most of the time working on... the graphical interface SDK! He took the job already done by me and the other guy and making a pretty hardcoded integration with the graphical interface and making everything that he tought it would be necesary. Soon enough the GitLab repository was totally outdated and completly useless. He had the totallity of the project in his half broken laptop, and sometimes he gave us a zip with all the code, outdated after a few minutes. Most of the stuff that I made was modified, a lot of the code was totally unknown to what it was and I had no idea even of how the folders were organised.
We had a month to finish it. I got totally disconected from the project and just hoped for the best, sometimes doing a handful of generic and adaptable lines of code for a specific thing (Funny enough, many core mechanics were nonexistent). The other guy managed to work more on the project, mostly fixing the mess that the guy did: apparently he didin't read the documentation of the SDK and just experimented and saw tutorials and tried to figure out how to do what he wanted.
Talking about documentation: we dont had yet. The code wasn't even commented propely. We did all that the last week and some stuff was finished the last night. The program apparently worked but I had no idea.
Thank God, the teacher just looked over everything and was very impressed by the working camera and the FF tiles. I don't think he saw the code or read too much of the documentation, much less when I directly wrote how I lost all access to the project.
I had a 10/10. I didin't complained. Most easy and annoying ten I ever had. I will never do a project with that guy. -
JS isnt the problem I have. I have realized. My problem is my lack of knowledge of the language which is not really a problem because I am new but its more the side I dont know how to write code that will do it. and lets say I do I get so fucking confident and it doesnt work and I think its some small error I made but no its just how I write it and it wont work and that gets me so down because when I ask for help my code 100% of the time gets rewritten. can I just not do simple shit on my own? and the problems Ive been coming across are just small projects to get better like "Create a function that outputs the most common item in an array" or "Write a simple JavaScript program to join all elements of the following array into a string" or literally any of the projects on this site: https://w3resource.com/javascript-e...
I feel so embarrassed because these are simple and I cant even do majority of them in langauges I'm better and more experienced with (python) I can think out a problem I cant convert that to code. algorithms in general I cant do as well and Ive never done any "big" or "serious" projects so I dont know what I have to show for the last 3 years of my life.10 -
Is it normal waiting 10 weeks since raise request to actually get a raise?
I understand that its summer, vacations are here and there, our branch is in EU and headquarters are US, but its been 10 freaking weeks.
Long story short I joined this company 5 months ago and because of a break I lowballed myself. After 3 months before my probation period I asked for a raise. So 10 weeks passed and since then I got a pat on a back saying that feedback is positive, but I cant pay my bills with that positive feedback.
I seriously started polishing my skills and think of leaving in a few weeks to couple months time because this is unnaceptable. I have no love for this job anymore and I will do bare minimum just like half of my team and if they dont like it they can fcking fire me (which never happened in 6 years of my career).
My asked bump is 43% but the thing is if I go contracting I will get 65%-105% more.
So fuck your corporate red tape, fuck your incompetent sleepy employees who drag everything out for weeks, fuck your vacation and fuck your 2 months bonus at the end of the year. I dont want to became a slow incompetent shit like all of you.2 -
i wanna be happy but i think im afraid of being happy, because being sad and alone is sort of comfortable at this point, since im like this since a long time ago. i still feel hurt bcs i feel so alone and i feel like a loser but im able to find distractions so i dont have to deal with all this guilt and sadness, but when things start working out in my life i keep thinking "do i deserve this?" and i get scared and really ashamed. scared of what people will think of me, scared of what they will do to me, ashamed of what people will and do think of me, so i just end up isolating myself all over again and being alone and sad and depressed all over again as well1
-
!dev
Why must I always be the guy that has to connect with people?
So I'm applying to a retail job, and the section manager, lets call him Tim, is kinda low energy.
Come in four days later after the first meeting, to just let him know I put in the application. We're talking, talking some more, and he basically wants to hire me but says it usually takes 1-2 weeks for the background. Well that's nonsense for a retail position doing stocking, but alright.
And I'm heading out the door, say to him "dont kill yourself on shift", he doesnt even laugh, just flat affect, monotone, "I know I still got an hour and a half on shift."
And as I'm driving away I'm thinking, that's how the entire conversation was like.
It wasn't just misery or tiredness. The dude, Tim, I'd seen that face and heard that tone before.
Its the behavior of someone who actively doesnt want to be alive.
And as I'm driving away, I'm just thinking, how do I go back? How do I go to this total stranger, who I'm also applying for a job with, who I just met, and say *look, I dont mean to get personal and this is probably uninvited but I know something's up with you. You were like this last time I met you, and you're like it even more now. I know bro. I know. You think no one sees you're going through something, but I do.*
I see shit like this and it's so obvious and by the time I realize I should say something, the opportunity has passed, the moment has passed. And it's like, is it even my place?
But to see someone like that, to be familiar with that look on their face, and to let them walk away...
I just dont know.4 -
OK, I think Ive figured out how I want to implement the core of my game.
Basic idea. Everything is made of sigils. What is a sigil? Lorewise, a representation of a concrete idea. Mechanically, it's a container for one or more ingame effects.
Again, anything you can think of, be it mundane or arcane, is a sigil. Every object attribute and method that causes a mutation of the game world state is composed of either a single or a sequence of sigils, known as a signa. You can do abstraction and have one thing encapsulate others, all that good stuff.
We go turnbased because tabletop rules. In your turn, you choose what to do with the sigils available to you. Common stuff like walk, talk, crouch, attack, et cetera are available to everyone.
You choose which effects to use, keeping in mind that order matters, and these effects either clash against or boost each other according to internal rules. Any relevant environmental modifiers around you or status effects apply here as well. Theyre also made of sigils, so theyre just implicitly components of the spell.
Finally, we get the result. An aura. It is simply the aggregate of all the sigils, containing the final transaction that will be applied to the game world, with dicerolls, if any are needed, already performed.
So here's the crucial bit. We record the aura for each turn, taken by either the player or the game itself, which includes the sequence of sigils used. Because each of these are words, or a series of words, it can be used narratively.
Let me give you an example. You are in a swamp, you use your turn to move around. This gives you an aura like so.
src: player, location: swamp, status: ok, walk.
We push that to a stack the game can see.
Now the game has to take its turn, and will look at the stack to get ideas. So lets say this swamp hindered your movement, gave you some trouble getting around. This is noteworthy enough as it affected something in the game world, and theres nothing else going on, so its made into a topic. The game will now pay attention to it and make it available for talking about.
topic: swamp-slow on player-party.
Everything is sigils, remember? Speaking is an effect, as is giving you something to talk about. Adding a topic results in an aura, push that to the stack.
Maybe then the game decides have the players companion make a comment on this topic. OK, just pair speak with other sigils to make an expression. The current topic is simply about a single negative effect, so one or two should be enough for a comment.
Factoring in the companions traits, also sigils, and the fact that for now this only a minor annoyance, we end up with an aura.
speak: topic -> complain about.
Do you see where this is going yet? The spellmaker gives us the means for text generation. The key here is instead of processing natural language like a bunch of dumbasses we just have an array of structures meant specifically for this purpose.
Anyway, the player now takes their turn. They can keep silent and continue moving, or say something as well. So let's say you pick the speak sigil too because why not, the current topic is also available to you, so you can reply. Depending on what the last message (aura) was, you get a range of options, and why not, let's factor in the player's chosen traits as well.
speak: shutdown -> complain about topic DOT change-topic -> mcguffin-quest.
We're on a mission to recover some plot stuff so shut up.
This results in further state changes, albeit behind the scenes. Our companion isn't happy, and we have a sequence of structures to prove it. Actions taken in relation to a topic can be associated with it if they're deemed significant, id est they caused a mutation of the game world's state.
speak: remind -> topic-name.
Thats right. Companion dude WILL remember that, you son of a bitch, and you bet your ass hes gonna bring it up if you keep acting like youre his boss or some shit. You dont even pay him!
You may say its such a small thing, but it all matters in a story. So we keep track of it, see what we can make this branch off into once a little more time has gone by.
What do you mean crazy, Im a fucking patrician of tenebrous arcana. You solve the problem by not solving the problem, obviously. Fuck natural language processing, all my homies use Litechnics to make narrative-driven programmable representations of the human condition.
Further rules include breaking gameplay down into scenes and acts as if it were theatre, because why not, and having baddies cooking shit up behind the scenes. Mechanism for that is the same, read the current stack and output structured wordsoup based on it.
We can even have a chorus narrating.
Or an audience reacting lmao.
OH GOD.
BUT I'M SO FRIGGIN SLOW OF A DEV.
WHAT IF I DON'T LIVE LONG ENOUGH TO IMPLEMENT THIS?
SHIT.
WORST SHOULD COME TO PASS,
PLEASE AVENGE MY DEATH.2 -
I starting developing my skills to a pro level from 1 year and half from now. My skillset is focused on Backend Development + Data Science(Specially Deep Learning), some sort of Machine Learning Engineer. I fill my github with personal projects the last 5 months, and im currently working on a very exciting project that involves all of my skills, its about Developing and deploy a Deep Learning Model for Image Deblurring.
I started to look for work two months to now. I applied to dozens of jobs at startups, no response. I changed my strategy a bit, focusing on early stage startups that dont have infinite money for pay all that senior devs, nothing, not even that startups wish to have me in their teams. I even applied to 2 or 3 and claim to do the job for little payment, arguing im not going for money but experience, nothing. I never got a reply back, not an interview, the few that reach back(like 3, from 3 or 4 dozen of startups), was just for say their are not interested on me.
This is frustrating, what i do on my days is just push forward my personal projects without rest. I will be broke in a few months from now if i dont get a job, im still young, i have 21 years, but i dont have economic support from parents anymore(they are already broke). Truly dont know what to do. Currently my brother is helping me with the money, but he will broke in few months as i say.
The worst of all this case is that i feel capable of get things done, i have skills and i trust in myself. This is not about me having doubts about my skills, but about startups that dont care, they are not interested in me, and the other worst thing is that my profile is in high demand, at least on startups, they always seek for backend devs with Machine Learning knowledge. Im nothing for them, i only want to land that first job, but seems to be impossible.
For add to this situation, im from south america, Venezuela, and im only able to get a remote job, because in my country basically has no Tech Industry, just Agencies everywhere underpaying devs, that as extent, dont care about my profile too!!! this is ridiculous, not even that almost dead Agencies that contract devs for very little payment in my country are interested in me! As extra, my economic situation dont allows me to reallocate, i simple cant afford that. planning to do it, but after land some job for a few months. Anyways coronavirus seems to finally set remote work as the default, maybe this is not a huge factor right now.
I try to find job as freelancer, i check the freelancer sites(Freelancer, Guru and so on) every week more or less, but at least from what i see, there is no Backend-Only gigs for Python Devs, They always ask for Fullstack developers, and Machine Learning gigs i dont even mention them.
Maybe im missing something obvious, but feel incredible that someone that has skills is not capable of land even a freelancer job. Maybe im blind, or maybe im asking too much(I feel the latter is not the case). Or maybe im overestimating my self? i think around that time to time, but is not possible, i have knowledge of Rest/GraphQL APIs Development using frameworks like Flask or DJango(But i like Flask more than DJango, i feel awesome with its microframework approach). Familiarized with containerization and Docker. I can mention knowledge about SQL and DBs(PostgreSQL), ORMs(SQLAlchemy), Open Auth, CI/CD, Unit Testing, Git, Soft DevOps Skills, Design Patterns like MVC or MTV, Serverless Environments, Deep Learning Solutions, end to end: Data Gathering, Preprocessing, Data Analysis, Model Architecture Design, Training and Finetunning. Im familiarized with SotA techniques widely used now days, GANs, Transformers, Residual Networks, U-Nets, Sequence Data, Image Data or high Dimensional Data, Data Augmentation, Regularization, Dropout, All kind of loss functions and Non Linear functions. My toolset is based around Python, with Tensorflow as the main framework, supported by other libraries like pandas, numpy and other Data Science oriented utils.
I know lot of stuff, is not that enough for get a Junior Level underpaid job? truly dont get it, what is required for get a job? not even enough for get an interview?
I have some dev friends and everyone seems to be able to land jobs, why im not landing even an interview?
I will keep pushing my Dev career, is that or starve to death. But i will love to read your suggestions! how i can approach this?
i will leave here my relevant social presence:
https://linkedin.com/in/...
https://github.com/ElPapi42
Thanks in advance!9 -
I've spent the whole day writing editing a proposal a partner sent as docx. I've tested out writing revisions and saved the file to be sure, and I could re-open it just fine. After some hours, I've sent the file to the partner and he said he couldn't open it. Looks like Libreoffice broke the document.xml file beyond repair when I edited my last comments. Will need to work until midnight because this piece of shit software is incapable of handling the basic document structure it is written for. IF YOU SUPPORT DOCX FILES HOW ABOUT YOUR RELEASE VERSIONS DONT LEAVE BROKEN CORRUPTED MESSES YOU PIECE OF SHIT. HOW MANY HOURS DO YOU THINK HAVE YOU COLLECTIVELY WASTED??1
-
what. fucking. day.
my ex blonde whore got mentally,
T O R M E N T E D.
ripped apart.
absolute, psychological, Destruction.
a great, great Evil, is gonna be born out of what ive done
worse than frankenstein evil
and this evil, will be spread across the entire world
it will infect and affect, you
i cannot imagine how fucked up the future is going to become
this day is completely FUCKED and i cannot wait for the moment till this shit is over
what happened?
too much random fucking bullshit happened! this day is as random as it can fucking get
warning: you'll gonna get a headache reading this fucking rollercoaster of emotions
1) worked
2) was angry at my ex blonde whore cause she doesnt want to block the fuckboy she cheated on me with
3) told her this. argued with her. shes stubborn and doesnt want to block him
4) i blocked her everywhere (for 500th fucking time). this time including ig. she cried at work. barely could focus
5) after work from a fake acc i saw she posted MY fucking bmw
6) second story she posted SITTING INSIDE OF MY FUCKING BMW WITHOUT MY FUCKING PERMISSION
7) WHAT THE FUCK. MAD AS FUCK, I called her on phone asap. she answered. i said i wanna talk. she wanted to go out for coffee. fuck that. lets go to her place. she asked u wanna fuck me. i said i fucking do. im horny too, she said
8) came over. fucked her. discussed. talked. argued afuckinggain. unblocked. i pretended ig glitched out and i saw that story. told her who the fuck u think u is to steal my fucking key of my bmw and sit in my fucking brand new bmw?!!! WHORE
9) then fucked her again. but cuddled her kissed her gently, she said "you're such a fucking mentally ill maniac", while smiling hugging me and kissing me. she loves The Joker type of guy who fucks with her emotions. "you give me rollercoaster of emotions" she said. when she went in shower to wash off my cum i grabbed her phone and blocked her fuckboy she cheated on me with (shes secretly in love with him)
10) when she saw this her whole fucking mood swapped. 180. asked why did u go through my phone. i said why did you fucking steal my bmw key and sit inside of it
11) now we're even. i crossed the red line and blocked your fucktoy from your phone and you crossed the red line stealing my fucking key of an expesnive car and sitting inside it at 7:30am while i was sleeping. Fuck you WHORE
12) she sent the pics of my fucking bmw to chatgpt and asked how much this car costs so she estimates how rich i fucking am. This relation is BEYOND FUCKING TOXIC AND LETHAL THAN YOU CAN IMAGINE
13) "now that hes blocked can you drive me in ur bmw now for the first time" she asked. i was resistent. I FUCKING blocked him not YOU, whore. and you're giving me an attitude now. she looked at me angry, deadly, the look of "im gonna do you dirty for this i promise". fuck that whore
14) at the end i said i can drive u only under the condition that he remains blocked forever
15) deal. i repeated the fucking seriousness of this numerous times. its gonna get more fucked and toxic if she ever unblocks him. we agreed so i drove the bitch whore for first time. she was amazed of my bmw
16) when i thought it was all over and i can relax, as we were driving ANOTHER BITCH CALLED ME ON MY PHONE. AND HER NAME AND NUMBER WAS DISPLAYED ON THE BMW SCREEN. FUUUUUUUUUUUCK. please
17) i completely forgot that i set up a coffee meeting with this new bitch. (this new bitch is fat and ugly btw i just wanted to go out with her cause she has good personality and wanted to talk random stuff so i shift my mind off blonde ex whore)
18) blonde ex whore was not happy. asked me who is that. FUCK. i said some random girl
19) i left my blonde whore home. kissed. then went over with that new girl for a drink. talked. drove her. blond ex attacked me who is she, and to give her phone number so she calls her to check what she has to do with me. FUCK!!!
20) as i was sitting with that new girl i had to explain her all this bullshit. embarrassed. belittled. fuckwd up. whilw i was explaining my blonde whore found her ig and told me to tell her everything or else shes blocking me.
21) the blonde whore blocked me! everywhere! lol. for the first time ever. fuck off. now she knows how i felt, betrayed!
22) fucked up. blonde ex wrote to new girl why did she call me and what do we have between each other cause shes my gf. WHAT FUCKING GF YOU DUMB BITCH YOU FUCKING CHEATED ON ME!!!!! FUCK YOU
23) i told this new girl to write her she needed me for college cause I'm an IT guy and they dumb af dont know how to use word or excel
24) blonde ex bought it (i think)
25) when i got home i called my blonde whore on phone. she answered. her voice seemed like she overdosed on drugs. "did u fuck that girl" she asked. No. i was riding my bmw.
26) explained her the new girl is ugly and just wanted college help. i wouldnt fk her (truth). ex whore unblocked me and said she wants me to cuddle her tomorrow and sleep in bed10 -
Thinking to start smoking 🚬
Never tried it once in 26 years not even a sip even refused temptations from school friends
Now by starting a job, i have no security, ironically. I feel like i stepped at the leap of a bottomless pit and tomorrow i jump into it and fall... and fall....and fall..... No end.
I have no idea how to use ansible and rexify.org and thats what I'll need to use. I have no idea how to do devops with Azure, and thats what ill do. I only build devops with terraform on Aws.
The unknown of 9-5 is frightening me more than starting a business. Paradoxically, i think it would come as a relief to get fired within the first week from failing to complete literally everything
On top of that my blonde gf disappeared yesterday for 3-4 hours. No texts no phone calls. Called for 2 times no answer. Called 3rd time and got a voice message the phone was shut down. 3-4 hours later she said she was with mom at shopping and didnt have internet
I also caught her texting some random guy on instagram. They both have vanish mode enabled (texts delete themselves as soon as you leave the conversation). Confronted her today. She wont tell me the truth. Likes his pics on ig. Keeps lying. On a question "why do you have vanish mode enabled with him?" her answer is "well i guess married men always use vanish mode"
Im tired
Too much shit unraveling. The opening of 2024 already doesnt look good
Why do good people die in accidents or diseases but i dont and i live? Shits unfair. Why doesnt nature/God fucking kill me? I beg to die. I hope to die. I pray for something to kill me. It would come as such a relief.
This life is meaningless and empty to me. typeof(life) yields a void. I dont value it. Its shit. Whether succeed or fail its meaningless. Nihilism was right
I am literally a walking dead. Physically moving but spiritually dead. Mentally lost. I am the captain of a ship in the middle of the ocean who no longer knows where the ship is going
Why cant i just get cancer or something. Can cigarettes help me get it? Cause I'll start consuming that shit right away to speedrun that process
End it
17 -
// Rant 1
---
Im literally laughing and crying rn
I tried to deploy a backend on aws Fargate for the first time. Never used Fargate until now
After several days of brainwreck of trial and error
After Fucking around to find out
After Multiple failures to deploy the backend app on AWS Fargate
After Multiple times of deleting the whole infrastructure and redoing everything again
After trying to create the infrastructure through terraform, where 60% of it has worked but the remaining parts have failed
After then scraping off terraform and doing everything manually via AWS ui dashboard because im that much desperate now and just want to see my fucking backend work on aws and i dont care how it will be done anymore
I have finally deployed the backend, successfully
I am yet unsure of what the fuck is going on. I followed an article. Basically i deployed the backend using:
- RDS
- ECS
- ECR
- VPC
- ALB
You may wonder am i fucking retarded to fail this hard for just deploying a backend to aws?
No. Its much deeper than you think. I deployed it on a real world production ready app way.
- VPC with 2 public and 2 private subnets. Private subnets used only for RDS. Public for ALB.
- Everything is very well done and secure. 3 security groups: 1 for ALB (port 80), 1 for Fargate (port 8080, the one the backend is running on), 1 for RDS postgres (port 5432). Each one stacked on top and chained
- custom domain name + SSL certificate so i can have a clean version of the fully working backend such as https://api.shitstain.com
- custom ECS cluster
- custom target groups
- task definitions
Etc.
Right now im unsure how all of this is glued together. I have no idea why this works and why my backend is secure and reachable. Well i do know to some extent but not everything.
To know everything, I'll now ask some dumbass questions:
1. What is ECS used for?
2. What is a task definition and why do i need it?
3. What does Fargate do exactly? As far as i understood its a on-demand use of a backend. Almost like serverless backend? Like i get billed only when the backend is used by someone?
4. What is a target group and why do i need it?
5. Ive read somewhere theres a difference between using Fargate and... ECS (or is it something else)? Whats the difference?
Everything else i understand well enough.
In the meantime I'll now start analyzing researching and understanding deeply what happened here and why this works. I'll also turn all of this in terraform. I'll also build a custom gitlab CI/CD to automate all of this shit and deploy to fargate prod app
// Rant 2
---
Im pissing and shitting a lot today. I piss so much and i only drink coffee. But the bigger problem is i can barely manage to hold my piss. It feels like i need to piss asap or im gonna piss myself. I used to be able to easily hold it for hours now i can barely do it for seconds. While i was sleeping with my gf @retoor i woke up by pissing on myself on her bed right next to her! the heavy warmness of my piss woke me up. It was so embarrassing. But she was hardcore sleeping and didnt notice. I immediately got out of bed to take a shower like a walking dead. I thought i was dreaming. I was half conscious and could barely see only to find out it wasnt a dream and i really did piss on myself in her bed! What the fuck! Whats next, to uncontrollably shit on her bed while sleeping?! Hopefully i didnt get some infection. I feel healthy. But maybe all of this is one giant dream im having and all of u are not real9 -
Need advice about switching to contracting.
TL;DR;
So I had 2 years of exp as an android dev, then I had a 1.5 year gap from doing android and now for the past 6 months Ive been doing android again fulltime. Im thinking of switching to contracting due to my debts and boring project and life crushing slow corporate processes in my current fulltime job, so I need tips and advices as to where should I start looking for new contracting gigs and in general what should I pay attention to. If it helps, I am based in EU, but am open to any EU/US gigs.
Now the full story:
Initially when I joined my current fulltime job after a break I had zero confidence, lowered my and employers expectations, joined as a junior but quickly picked up the latest standards and crushed it. Im doing better than half devs in my scrum team right now and would consider myself to be a mid level right now.
Asked for a 50% bump, manager kinda okayed it but the HQ overseas is taking a very long time to give me the actual bump. I have been waiting for 10 weeks already (lots of people in the decision chain were on and off vacations due to summer, also I guess manager sent this request to HQ too late, go figure). Anyways its becoming unnaceptable and I feel like its time for a change.
Now since I have mortgage and bills to pay, even with the bump that I requested that would leave me with like maximum 700-800 bucks a month after all expenses. I have debts of around 20k and paying them back at this rate would take 3 years at least and sounds like a not viable plan at all.
Also it does not help that the project Im working on is full of legacy and Im not learning anything new here. Corporate life seems to be very slow, lots of red tape kills creativity and so on. I remember in startups I was cooking features left and right each sprint, in here deploying a simple popup feature sometimes takes weeks due to incompetence in the chain. I miss the times where I worked in startups, did my job learned nre skills and after 6 months could jump on another exciting gig. Im not growing here anymore.
So because my ADD brain seems to be suited much better for working in startups, and also I need to make more money quick and I dont see a future in current company, I am thinking of going back to contracting. All I need right now is to build a few side apps, get them reviewed by seniors and fill my knowledge gaps. Then I plan of starting interviewing as a mid level or even a senior for that matter, since I worked with actual seniors and to be honest I dont think getting up to their level would be rocket science.
Only difference between mid and senior devs that I see atleast in my current company is that seniors are taking on responsibility more often, and they also take care of our tools, such as CD/CI, pipeline scripts, linters and etc. Usually seniors are the ones who do the research/investigations and then come up with actual tasks/stories for mids/juniors. Also seniors introduce new dependencies and update our stack, solve some performance issues and address bottlenecks and technical debt. I dont think its rocket science, also Ive been the sole dev responsible for apps in the past and always did decent work. Turns out all I needed was to test myself in an environment full of other devs, thats it. My only bottleneck was the imposter syndrome because I was a self taught dev who worked most of my career alone.
Anyways I posted here asking for some tips and advices on how to begin my search for new contract opportunities. I am living in EU, can you give me some decent sites where I could just start applying? Also I would appreciate any other tips opinions and feedback. Thanks!3 -
In the first place I dont do it that often in private projects because the estimation is always wrong.
At work i just think about best and worst case scenario and the average time it could take. If the the worst case scenario is really time intensive and there are a lot of factors that could go wrong in contrast to the best case, I significantly increase the estimated time for the task. Otherwise its 1/6 best case; 1/6 worst case; 4/6 average time2 -
Hey guys,
I have to Select my Bachelor thesis/topic in the next few days. I would like to do something with Crypto Currencies especially with the Blockchain System. There is a wide range of usage for that and i Think it could be very interesting.
The Problem is that am Not Really Sure what Topic or challenge my Project could contain. There is much to say about it but i dont Think it would be enough to just describe it.
There should be a Problem or anything like that I can solve..
Or Is it possible to just Analyse the blockchain and the affect it have These Days and the Future?
I would appreciate a few ideas or suggestions :)
Regards
Birdy513 -
next week im buying my first ever car. its gonna be a benz. im literally taking a cash credit loan from a bank B, just for deposit of the car, and then taking another loan from bank A, to be able to buy the car on leasing for the next 3 years.
basically I'll be giving away my whole entire salary of 2024 that i worked as devops engineer, plus cash credit, plus leasing credit, just for a fucking deposit of the car, and the car costs only 35,000 fucking euros €!
thats not a big fucking deal. ppl drive 90,000€ cars every fucking day. or 50,000€ cars as an average. i am buying a below average car, or for me The Bare Minimum Car... and i still struggle like hell to do it.
im willing to go broke buying this car bc a car would never cheat on me. it would never lie to me. a beautiful car standing outside of my house always there to remind me why this meaningless fucking existence called life, is still worth living.
a car for me is beyond just a car or art. it gives me meaning to continue living. life by default for me is valueless. a beautiful car and mine, finally generates value of life. every time i get depressed (which is every day) i take a nice night ride in my new benz
its a 2020 car. and im satisfied with it. i also got offers to buy the brand new 2024 one. but that shit is almost twice as much in costs. dont have money for that shit. I'd need to work my shit job for at least 3 more months and save every penny JUST FOR DEPOSIT.
out of my budget.
im buying a CLA class. i wanted C class but that shit mad expensive! i think A class is too cheap for me so the only class i can afford and not look cheap is CLA. C class is the next tier. I'd need 2 more salaries for C class but only 1 more salary for CLA, hence next week (first week of september)
hopefully, this new car will get me new whores. i really do hope that whores will fuck w a nice car and want to finally go out with me. i dont care if they're using me for money (which im not even gonna have). i care about using these whores as a form of revenge for my ex whore blonde cheating on me for the past 2+ years
so aside from clearing my mind of bullshit by driving a nice car at night which i fully bought myself no handouts, driving whores in it would just be cherry on top of the cake. a bonus.
lets see how it goes.15 -
Need some advise from all you clever devs out there.
When I finished uni I worked for a year at a good company but ultimately I was bored by the topic.
I got a new job at a place that was run by a Hitler wannabee that didn't want to do anything properly including writing tests and any time I improved an area or wrote a test would take me aside to have a go so I quit after 3 months.
Getti g a new job was not that hard but being at companies for short stints was a big issue.
My new job I've been here 3 months again but the code base is a shit hole, no standardisation, no one knows anything about industry standards, no tests again, pull requests that are in name only as clearly broken areas that you comment on get ignored so you might as well not bother, fake agile where all user stories are not user stories and we just lie every sprint about what we finished, no estimates and so forth, and a code base that is such a piece of shit that to add a new feature you have to hack every time. The project only started a few months back.
For instance we were implementing permissions and roles. My team lead does the table design. I spent 4 hours trying to convince him it was not fit for purpose and now we have spent a month on this area and we can't even enforce the permissions on the backend so basically they don't exist. This is the tip of the iceberg as this shit happens constantly and the worst thing is even though I say there is a problem we just ignore it so the app will always be insecure.
None of the team knows angular or wants to learn but all our apps use angular..
These are just examples, there is a lot more problems right from agile being run by people that don't understand agile to sending database entities instead of view models to client apps, but not all as some use view models so we just duplicate all the api controllers.
Our angular apps are a huge mess now because I have to keep hacking them since the backend is wrong.
We have a huge architectural problem that will set us back 1 month as we won't be able to actually access functionality and we need to release in 3 months, their solution even understanding my point fully is to ignore it. Legit.
The worst thing is that although my team is not dumb, if you try to explain this stuff to them they either just don't understand what you are saying or don't care.
With all that said I don't think they are even aware of these issues somehow so I dont think it's on purpose, and I do like the people and company, but I have reached the point that I don't give a shit anymore if something is wrong as its just so much easier to stay silent and makes no difference anyway.
I get paid very well, it's close to home and I actually learn a lot since their skill level is so low I have to pick up the slack and do all kinds of things I've never done much of like release management or database optimisation and I like that.
Would you leave and get a new job? -
I love linux because i dont have to forced to do frickin update like windows did.
Because i have an experience after update linux mint i cant even start the main GUI program. After boot only show blank console. It seem linux update broke the compatibility between my graphics card.
At least now i dont have to update because thats an option. The output of update is not different than windows.there is a chance you broke your OS.
But the struggle is when i need to install new app in linux. Sometimes need more than hour to find out why it doesnt work from the first time.
Any help here?
So this start from the office. In the office i usually use low spec laptop that work slowly. Then i found this IDE called rapidclipse. Its very promising with GUI builder and can build cross platform mobile app using only java built on top vaadin framework.
When i use it on low spec laptop hackintosh at office it work well although it take more time than other kind of eclipse and i dont need to install any kind of app again, just download-install-create new project-run on tomcat-work well.
Then i go to home to try this new tool , IMO my low spec PC still have more power to run something than old hackintosh. Because usually i use android studio with no problem. In the old hackintosh it went too long to build gradle only.
Then i install rapidclipse, then run desktop shortcut. Then it said i need to install correct java to use correct JavaFX.
After search on SO they said i must install jdk from oracle.
Ok so i got openjdk in my linux.wtf what is the different idk but dont have time to find out.
I install jdk from oracle.
Than finally can open the rapidclipse.
Wow , this gonna be fun.
Then create new project. Just a new project.
So im waiting. I see the progress at 10%. But still no increment on that.
I switch to other app for several minutes.
Then when switched back th app still at 10% and now is at no responding state. So i force close.
After that open rapidclipse again.
The previous new project can be opened. Yay, i think.
But so many error there. Omg.
So i create new project again.
But, but, i just repeated the first error then close again then try it again for several time. But still same output.
After an hour, i give up.
But still, why , just why it work like this. No error or whatsoever.
Back later i have a problem like this on different app.
Idkwhy.1 -
Hello people i have this problem and i think it is serious because it happens chronically. I am trying to get the word out about business services that i offer, but immediately they think its a scam. They dont know what company it is, or what it offers, or if it even exists yet, but “it sounds like a scam” … ? Is it a scam or not?
Do not do this. Always verify the source of your information to its legitimate source to know that its legitimate. Do not quickly assume that its a scam because because your pancreas gurgled. Your organs cant tell u whether something is a scam.
By just assuming, u display unprofessionalism by making an ass of yourself in front of a real agency. U also make yourself more prone to real scams who can act like what u think is legitimate. U also lose any opportunities u could have had, because u had to be an ass when it was being offered to u. Dont do that.5 -
How do you deal when you are overpromising and underdelivering due to really shitty unpredictable codebase? Im having 2-3 bad sprints in a row now.
For context: Im working on this point of sale app for the past 4 months and for the last 3 sprints I am strugglig with surprises and edgecases. I swear to god each time I want to implement something more complex, I have to create another 4-5 tickets just to fix the constraints or old bugs that prevent my feature implementation just so I could squeeze my feature in. That offsets my original given deadlines and its so fucking draining to explain myself to my teamlead about why feature has to be reverted why it was delayed again and so on.
So last time basically it went like this: Got assigned a feature, estimated 2 weeks to do it. I did the feature in time, got reviewed and approved by devs, got approved by QA and feature got merged to develop.
Then, during regression testing 3 blockers came up so I had to revert the feature from develop. Because QA took a very long time to test the feature and discover the blockers, now its like 3 days left until the end of the sprint. My teamlead instantly started shitting bricks, asked me to fix the blockers asap.
Now to deal with 3 blockers I had to reimplement the whole feature and create like 3 extra tickets to fix existing bugs. Feature refactor got moved to yet another sprint and 3 tickets turned into like 8 tickets. Most of them are done, I created them just to for papertrail purposes so that they would be aware of how complex this is.
It taking me already extra 2 weeks or so and I am almost done with it but Im going into really deep rabbithole here. I would ask for help but out of other 7 devs in the team only one is actually competent and helpful so I tried to avoid going to him and instead chose to do 16 hour days for 2 weeks in a row.
Guess what I cant sustain it anymore. I get it that its my fault maybe I should have asked for help sooner.
But its so fucking frustrating trying to do mental gymnastics over here while majority of my team is picking low hanging fruit tasks and sitting for 2 weeks on them but they manage to look good infront of everyone.
Meanwhile Im tryharding here and its no enough, I guess I still look incompetent infront of everyone because my 2 weeks task turned into 6 weeks and I was too stubborn to ask for help. Whats even worse now is that teamlead wants me to lead a new initiative what stresses me even more because I havent finished the current one yet. So basically Im tryharding so much and I will get even extra work on top. Fucking perfect.
My frustration comes from the point that I kinda overpromised and underdelivered. But the thing is, at this point its nearly impossible to predict how much a complex feature implementation might take. I can estimate that for example 2 weeks should be enough to implement a popup, but I cant forsee the weird edgecases that can be discovered only during development.
My frustration comes from devs just reviewing the code and not launching the app on their emulator to test it. Also what frustrates me is that we dont have enough QA resources so sometimes feature stands for extra 1-2 weeks just to be tested. So we run into a situation where long delays for testing causes late bug discovery that causes late refactors which causes late deliveries and for some reason I am the one who takes all the pressure and I have to puloff 16 hour workdays to get something done on time.
I am so fucking tired from last 2 sprints. Basically each day fucking explaining that I am still refactoring/fixing the blocker. I am so tired of feeling behind.
Now I know what you will say: always underpromise and overdeliver. But how? Explain to me how? Ok example. A feature thats add a new popup? Shouldnt take usually more than 2 weeks to do my part. What I cant promise is that devs will do a proper review, that QA wont take 2 extra weeks just to test the feature and I wont need another extra 2 weeks just to fix the blockers.
I see other scrum team devs picking low hanging fruit tasks and sitting for 2 weeks on them. Meanwhile Im doing mental gymnastics here and trying to implement something complex (which initially seemed like an easy task). For the last 2 weeks Im working until 4am.
Im fucking done. I need a break and I will start asking other devs for help. I dont care about saving my face anymore. I will start just spamming people if anything takes longer than a day to implement. Fuck it.
I am setting boundaries. 8 hours a day and In out. New blockers and 2 days left till end of the sprint? Sorry teamlead we will move fixes to another sprint.
It doesnt help that my teamlead is pressuring me and asking the same shit over and over. I dont want them to think that I am incompetent. I dont know how to deal with this shit. Im tired of explaining myself again and again. Should I just fucking pick low hanging fruit tasks but deliver them in a steady pace? Fucking hell.4
