Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "im scared"
-
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
An intern I was supposed to lead (as an intern) and work with. Which sounded kinda crazy to me, but also fun so I rolled with it. But when I met her I quickly found out she didn't even have a coding editor installed and when I advised one she was "scared of virusses". She had Microsoft Edge in her toolbar, and some picture of a cat as a background. We were given some project by our boss, and a freelance programmer helped us set it up on Trello. Great, lets start! Oke maybe first some R&D, she had to reaeach how to use the Twilio API. After catching her on WhatsApp a few times I realised this wasnt gonna go anywere. After a few weeks of coding and posting a initial project to git I asked her if she could show me the code of the API she made so far..
She told me she was using the quickstart guide (the last 3 FUCKING weeks) which contained some test project with specific use cases.
The one that I did 3 weeks ago that same fucking morning.
AND SHE WAS STILL NOT DONE...
A few days later I asked her about the progress (strangly, I wasn't allowed ti give her another task bcs the freelanc already did) and guess what... She got fking pissed at me
Her: "I will come to you when im done, ok?"
Me: "I just want to see how it is going so far and if you are running into any problems!"
Her: "I dont want to show you right now"
She then goes to my fucking boss to tell him I am bothering her.
And omg... Please dear god please kill me now...
Instead of him saying the she probably didn't do shit. He says to me that the girl thinks im looking down on her and she needs a stress free environment to work in. She will show me when its done. ITS A FUCKING QUICKSTART GUIDE YOU DUMB BITCH.
He then procceeded to whine to me about the email template (another project I do at the same time) which didn't look perfect in all of his clients.
Dont they understand that I am not a frontend developer? Can you stop please? I know nothing about email templates, I told you this!!!
Really... the whole fucking internship the only thing the girl did was ask people if they want more tea. Then she starts cleaning the windows, talk to people for an hour, or clean everyone's dask.
all this while I already made 50% of the fucking product and she just finished the quickstart tutorial 😭. Truly 2 months wasted, and the worse thing is I didn't get any apprication. They constantly blamed me and whined at me. Sometimes for being 3 minutes late, the other for smoking too much, or because I drink to much coffee, or that I dont eat healthy. They even forced me to play Ping Pong. While im just trying to do my job. One of the worst things they got mad at me for if when my laptop got hacked bcs it was infected with some virus. He had remote access and bought 5 iPhones 6's with my paypal while I was on break. I had to go home and quickly reset all my passwords and make sure the iPhones wouldnt get delivered. strange this was, this laptop I only used at the company. So it must have been software I had to download there. Probably phpstorm (torrent). Bcs nobody would give me a license. And the freelancer said I * have to *.
the monday after I still had to reinstall windows so I called them and said I would be late. when I came they were so disrepectfull and didn't understand anything. It went a little like this:
Boss: why u late?
Me: had to reinstall my laptop, sorry.
Boss: why didnt you do this in your own time?
Me: well, I didn't have any time.
Boss: cant you do this in the weekend or something? Because now we have to pay you several hours bcs you downloaded something at home.
Me: I am only using this laptop for work so thats not possible.
Boss: how can that even be possible? You are not doing anything at home with your laptop? Is that why you never do anything at home?
Me: uhm, I have desktop computer you know. Its much faster. And I also need to rest sometimes. Areeb (freelancer) told me to torrent the software. He gave me the link. 2 days later this happends
Boss: Ahh okeee I see.. Well dont let it happen again.
After that nobody at the compamy trusted me with anything computer related. Yes it was my own fault I downloaded a virus but it can happen to anyone. After that I never used Windows again btw, also no more auto login apps.8 -
What If our Boss's read our Rants...
OH GOD NO!
But
What If they write there OWN rants about us?
Now im scared8 -
I'm fairly certain my boss'.....boss (didn't want to count them.. it's high up the chain, and slightly lateral) thinks I'm incredibly weird. I have too many sports injuries to be fully functional and they all flare up while I'm sitting at my desk. To offset this, I stand up or walk around while on the phone, and occasionally stretch.
These stretches are for hip and it band, usually, which are a bit more involved, so of course he ONLY fucking walks into the damn office while I'm stretching. (Image search for hip stretch).
To top it off, I have an unfortunate colored ointment for the pain in my elbow that i was applying today while stretching, and im scared to know what he was thinking before he realized what was actually going on. Imagine hip stretching (this one with leg on desk) while rubbing milky sort of clear ointment into skin...
Sir, if you're reading this, I promise I'm not actually that weird at work, you just have shitty timing.5 -
Im so frustrated with myself . I've always been afraid of being stupid . Perhaps it was because i was always called the "less intelligent" sibling by my parents . Well i did self-learn java , c++ and android (when i was 15) and made some apps and i did get acknowledged finally but i may have not acknowledged myself . I got into college a couple years ago and i can tell you right out that its like an island filled with stupidity. The teachers , the students. The other day i caught my teacher learning how a transistor works. This is unacceptable for someone who is teaching us advanced op-amps and other circuits . Well , I did get into this college cause it was less tedious and i thought college doesn't matter cause i can self-learn . All i needed was free time . Well college totally destroyed that too and provided no facilities in the process as well . So yeah should i blame my college for my inability to do things the past couple years. I mean i don't think i've learnt a single thing all this while. This is where my frustration begins cause i dont want to blame the college , it's not going to help me and i'll probably end up in a 9 to 5 call center job at this rate . Im also very heavily frustrated with myself , it's like everything i've done so far has been a path of least effort. I have tried a few things which were all just fads like machine learning and crypto and even trading . They felt good and thats what scares me , maybe i don't have the passion and am just looking for a quick buck . This is clearly reflected in the ideas i've been having as well . Well i've never had access to proper funds but now im just trying to justify this layman emotion . I just want to learn and be passionate about learning , researching and i just want enough funds for that . But im afraid , maybe its just that i want to feel superior than my circle . I mean i still don't know why i tried learning rust and wasted even more time setting up fedora and everything around it while i already had a working debian setup and a programming language i'm kind of versed with . i wouldn't say well cause im a self learner and i feel guilty for that . I definitely know i just learnt the surface of the language . Deep down i'm just another stupid fad obsessed guy who feels better by choosing a more complex language that my colleagues look upto . Is this what i am , if so im scared and i don't know what to do . People say that you are what you are and you cant change that . If i cant change this then i dont deserve this wasteful stupid life . I don't know what i should do and it makes me cry . Maybe acknowledging this would've helped but it hasn't , I've felt better playing fortnite rather than learning some basic electronics. Im another one of those aren't I ?17
-
My life didnt go as smooth as i expected. Everything happened as expected, i knew what going to the uni requires, i knew everything...
But i didnt accounted for my mental health. Since forever i have thought that im lazy or something like that, that i can do everything i just have to do it. Oh how wrong was I. It went from my projects being frozen for a long time due to lack of motivation to neglecting important living activies. Even my health suffered a bit. Everytime i failed, even the simplest task no matter why i always felt even worse. Even the most basic tasks were unimportant for me. Even some minor tasks that i failed gave me huge guilt. Not to mention that my family wont help me with my mental health at all, (they cant see what is realy happening they always think im lazy) (but maybe they could fucking figure out that being sad liteary for years is bad). My contact with friends is limited, im always scared to go or more often scared to ask is they have time to meet because they are ALWAYS busy...
So that was my life, alone, against people who were demanding (and my mother who thought that her hard work was everything i needed, but no. Money, food and clean house isnt everything that human requires to propely function!). Now I have scheduled a meeting with the specialist, i hope the uni has better ones than the other ones i had. I hope he will help me and i will get out that life downwards spiral.5 -
I don't know if I'm being pranked or not, but I work with my boss and he has the strangest way of doing things.
- Only use PHP
- Keep error_reporting off (for development), Site cannot function if they are on.
- 20,000 lines of functions in a single file, 50% of which was unused, mostly repeated code that could have been reduced massively.
- Zero Code Comments
- Inconsistent variable names, function names, file names -- I was literally project searching for months to find things.
- There is nothing close to a normalized SQL Database, column ID names can't even stay consistent.
- Every query is done with a mysqli wrapper to use legacy mysql functions.
- Most used function is to escape stirngs
- Type-hinting is too strict for the code.
- Most files packed with Inline CSS, JavaScript and PHP - we don't want to use an external file otherwise we'd have to open two of them.
- Do not use a package manger composer because he doesn't have it installed.. Though I told him it's easy on any platform and I'll explain it.
- He downloads a few composer packages he likes and drag/drop them into random folder.
- Uses $_GET to set values and pass them around like a message contianer.
- One file is 6000 lines which is a giant if statement with somewhere close to 7 levels deep of recursion.
- Never removes his old code that bloats things.
- Has functions from a decade ago he would like to save to use some day. Just regular, plain old, PHP functions.
- Always wants to build things from scratch, and re-using a lot of his code that is honestly a weird way of doing almost everything.
- Using CodeIntel, Mess Detectors, Error Detectors is not good or useful.
- Would not deploy to production through any tool I setup, though I was told to. Instead he wrote bash scripts that still make me nervous.
- Often tells me to make something modern/great (reinventing a wheel) and then ends up saying, "I think I'd do it this way... Referes to his code 5 years ago".
- Using isset() breaks things.
- Tens of thousands of undefined variables exist because arrays are creates like $this[][][] = 5;
- Understanding the naming of functions required me to write several documents.
- I had to use #region tags to find places in the code quicker since a router was about 2000 lines of if else statements.
- I used Todo Bookmark extensions in VSCode to mark and flag everything that's a bug.
- Gets upset if I add anything to .gitignore; I tried to tell him it ignores files we don't want, he is though it deleted them for a while.
- He would rather explain every line of code in a mammoth project that follows no human known patterns, includes files that overwrite global scope variables and wants has me do the documentation.
- Open to ideas but when I bring them up such as - This is what most standards suggest, here's a literal example of exactly what you want but easier - He will passively decide against it and end up working on tedious things not very necessary for project release dates.
- On another project I try to write code but he wants to go over every single nook and cranny and stay on the phone the entire day as I watch his screen and Im trying to code.
I would like us all to do well but I do not consider him a programmer but a script-whippersnapper. I find myself trying to to debate the most basic of things (you shouldnt 777 every file), and I need all kinds of evidence before he will do something about it. We need "security" and all kinds of buzz words but I'm scared to death of this code. After several months its a nice place to work but I am convinced I'm being pranked or my boss has very little idea what he's doing. I've worked in a lot of disasters but nothing like this.
We are building an API, I could use something open source to help with anything from validations, routing, ACL but he ends up reinventing the wheel. I have never worked so slow, hindered and baffled at how I am supposed to build anything - nothing is stable, tested, and rarely logical. I suggested many things but he would rather have small talk and reason his way into using things he made.
I could fhave this project 50% done i a Node API i two weeks, pretty fast in a PHP or Python one, but we for reasons I have no idea would rather go slow and literally "build a framework". Two knuckleheads are going to build a PHP REST framework and compete with tested, tried and true open source tools by tens of millions?
I just wanted to rant because this drives me crazy. I have so much stress my neck and shoulder seems like a nerve is pinched. I don't understand what any of this means. I've never met someone who was wrong about so many things but believed they were right. I just don't know what to say so often on call I just say, 'uhh..'. It's like nothing anyone or any authority says matters, I don't know why he asks anything he's going to do things one way, a hard way, only that he can decipher. He's an owner, he's not worried about job security.12 -
Hi
I'm an active user here so I know most of you.
I created a throwaway because I consider this a sensitive subject to me, and don't want people here to think I'm crazy.
I have some form of ocd but I don't know exactly which subtype it is.
It's not really something that makes my life impossible, but it makes me feel awful from time to time.
the way it works is that I imagine accidents happening to me or people I love, and I get triggered more if they are potentially caused by a mistake from me and they feel very vivid in my mind.
It's awful and terrifying.
Being close to anything that could cause harm is a trigger:
heights without any type of fall protection, knives, elevators, escalators, being on a plane
Being close to/in said objects/situations can start a clip in my mind as if I was watching a final destination movie.
This is a stronger obsession if it happens because of my fault, like tripping with my kid in my arms, or fumbling a knife while I cook.
Sometimes I react by curling and doing a painful expression and twitching a bit, even in public.
it's terribly painful.
i look like a crazy person, although considering what I'm writing, i probably am. It's just that I feel very scared of strangers in public noticing what I'm doing and finding out I'm crazy.
sometimes I get scared of the possibility of me being an actual psycho like the ones you see on crime shows.
as far as i know i think im normal in terms of compassion, empathy to others and never had any interest in harming others.
it's just part of the ocd, being hypervigilant of me, obsessing over me causing harm either accidentally or deliberately.
I'm also very scared of puking in public, or even worse, in front of friends.
Specially true if you're eating but you're seated in a spot where there's no way out except if everybody gets up.
I start by becoming self conscious of the possibility of puking, and sometimes I twitch a bit too, while trying to not look too crazy and joping that the next bite doesn't cause me to projectile vomit over people.
I hate this shit.15 -
I got an interview with a big multinational software company as a senior dev - the kind of place I never thought I would be privileged or knowledgeable enough to work for and wasnt expecting to get In to...
I aced it. They gave me an offer but - FOR DEVOPS 😬
basically my skills fit in perfectly with the server/ scaling issues they have and are far more valuable there. I know they do, I also know I can fix the issue and will have alot of fun coding it - I just dont think I want to monitor it or anything else.
I mean I do devops stuff all the time in aid of anything I code but their stack is a full time job- im scared that once the toolchain is automated ill be pulled towards sys admin like duties and lose touch with my craft... what do you guys think? Anyone shifted from dev to devops?9 -
FUCK YOU MAGNETO!!!!!
what a backstabing cunt
imagine you're trying to prevent world war 3 from happening with someone you've been training for months.
out of nowhere, this FUCKING PICE OF SHIT decides to become a vilain.
in the midst of the event he tries to deflect a bullet that ricochets into my spine.
thanks asshole, now I can't walk
i thought we were friends man, we bonded over painful shit
like ok, they killed your mom and made experiments with you,
but it was just the NAZIS, LITERALLY EVERYBODY HATES THEM.
take it out on them, not the entire humanity bro
you unlocked your powers thanks to me, you couldn't even lift the toilet seat.
and you don't even give a fuck about mutants, you power hungry bitch
you only care about total domination
"oh no, someone save us from this mutant whose real name is eric"
im so scared right now9 -
Personal update:
So i have been to psychiatrist few days ago. I got a prescription for anti depression drugs and today is the 4th day of my therapy. I feel a bit better. At least i can sleep can focus on things. Unfourtanetly mentaly i dont feel better. That rant that i wrote before didnt help me neither (i deleted it). That drug that im taking has a shit ton of possible side effects uncluding anger. My massive untrust to people dosent help neither.
To anybody who didnt read the previous rant. I have meet a classmate that had a idea for a android app. I have fought he is one of that bad, stupid kind. I was wrong i said bad things to him but eventualy i helped him by showing where he can get help with the app.
I shouldnt have responded to him in the first place. Now i feel bad. I have no idea how you are going to respond im scared. I prejudged him but im now sorry. I have no idea how my life is going to go.
I also have tried applying for a awesome C# internship, perfect for a student: paid and might get experience in C#. I have send them 2 emails on the address that they gave me during open days (where i had talked with HR and devs personaly about their job) and i got no responce since last month...
Finals for the first semester are closing in as well. I dont know if im going to pass or not. And that is the worst thing i have to worry about now.3 -
Random thoughts that I need to put somewhere. that I’ve been holding in and have to get out.
I feel like I’m more welcomed and wanted here than in real life. My friends don’t really think about me when making plans anymore, no one really thinks of me in general.
In school I was the awkward kid that was nice to everyone and I’m not taking the whole graduation well. I miss high-school and my vocational school, I miss my friends and I’ve just felt like things ended too soon and I just kinda feel alone
I wish I could just sit down and program and not procrastinate the only time I seem to be able to get stuff done is when I force myself. I feel like I’m such a shitty developer for not fighting it better. I need to be better.
I’ve not had a good few weeks. Since I’m taken a semester off from college no one in my family besides me is able to stay with a family member that’s in the hospital. I volunteered because I care for them deeply and want to help them. but it takes a huge toll on me since I have to be the one that listens to the doctors tells the rest of my family what’s happening. While Im kinda freaking out because I’m scared and nervous and NOT READY and I’ve had to stay a week there and I’ve been having to stay on and off and I haven’t really told anyone how I really am feeling about it all because I don’t like to be vulnerable in front of people and it’s been really hard and taking a toll and not helping the procrastination.4 -
I just oversleeped...
Im not a dev yet, i have a contract job at the factory.
I have worked 1month already from 3 that i singned up for.
The worst thing is that i said i need a day off to give specific papers for my university. It was supposed to be today but i moved it tomorrow due to the problem with transport.
Well my superior is propably realy angry right now... On the bright side i will have 2 days off...
I wont get fired (hopefully) because as contract job they should only substracy the daily pay from my monthly salary.
This is my first time that im late for a real job. My intuition says that i should go but i wouldnt bear the shame... If i were to go i would be late minimaly 2 hours. I have no idea what to do... I will propably stay home and lose the daily payment because im not strong enough to bear the shame today. It would be very difficult to get in the company as well. Ahhhhh! Its difficult to make decisions when you are shy, lazy and scared.5 -
How do I help my colleague in fighting harrassment?
This is the story of a helpless employee facing everyday harassment. Im trying to help. Seeking for your thoughts
Backstory fast forwarded: My company acquired another company. So we handle all their projects and clients now, but its a completely new domain. So we needed new people. Hired 4 employees + 1 team lead to start with. But the project process got delayed and they were free for a month. So i took 2 of them in my project and gave them some small tasks to help us over. They loved working with my team and were learning new stuff apart from what they usually did. And we were also happy of their contribution. We became good friends. All of this was in March 2020 before covid-19 was taken seriously.
About my company: I love this company. I have been in this company for more than 4 years now. People are really nice. Parties and fun events. Lot of smart and ambitious people. So company and people are awesome.
Coming back to the story. Lets call the team the 4 and team lead T. The 4 were happy that someone like T was in their team. This T had all the best knowledge about stuff and life was going to be awesome for the 4. Or was it?
Story starts: So I talk to one of these 4 on daily basis. Lets call this friend F. F is a real gentle person. Intelligent and dedicated to work. F is awesome to work with. And always enjoyed working. F is a team player and very very soft person. F is fking workoholic. So few days after project starts, F tells me work was not going well. F is getting real frustrated at work and not able to deal with it or find solution.
What happened:
This person T, who was supposed to help these 4, is real piece of shit. He is impatient, arrogant and MFing dick head. Aaaarggggg.
All the good qualities of a leader like supporting the team, boosting confidence, guiding team when they make mistakes, teaching them, were all missing from this person. T was a machine with no emotion and only clock working jerk. I have no idea how T cleared interview process, because one of the interview round is also about cultural fit into company. I know this because i take interviews for other domains. We have rejected lot of such well qualified but arrogant candidates.
So whats the problem now: this team of 4 are learning new tools and taking over the clients requests from old company. Most of the stuff is new for them. So in tat case people need lot of time to understand and figure out shit. people make mistakes while learning and you know have to deal with it. Person T abuses these 4 when something goes wrong. That's one.
Second, the T definitely knows more than these 4. So if these guys dont understand certain stuff they ask T. But T does not help them learn. T will either say busy or run away by saying thats simple and ull know when time comes. REALLY MF???
Third, T does not talk nice. T is rude and does not listen to team members. For eg, If F says some task cannot be done for some reason T will say, "y cant u do it? U r capable of doing it. Tats y u r in this job". And then point number one and two happens. Never responds to emails and messages. But if someone else does the same will not tolerate that and abuses them. List goes on.
So y not escalate and deal with that T:
This person F and other 3 are still under probation and they think complaint or escalation will back fire. These people do not want to lose job in between all this pandemic shit. They are scared.
So this was happening for a while. And i was giving lot of tips on how to handle certain situations. And how one should communicate these.
But being a gentle, soft and workoholic person, F focussed on work and assumed things will get in place as time goes by.
Today, F could not meet a requirement. So T told some shit which got F all sad. and F called up me late night and started crying explaining what happened. I felt real bad. I asked F to file harrassment case. F refused saying it was F's mistake on not completing requirement. WHO THE FK CARES. PEOPLE CANNOT TALK SHIT. I told ill file harrassment case against T. (We have a policy where others can also file if person is not courageous enough). But F did not allow me.
Then after calming down, I told F that telling the problems to me wont solve them. You have to talk to T directly and tell him on face not to talk like this. Or tell the manager about whats happening. Or tell the the HR about this. F said tat cant be done. I was like Y THE FK NOT.
Because the other 3 are not ready to talk about this to anyone as they fear they'll lose job. So if F talks and people question other 3 they might bail out. WAT THE HOLY SPIRIT.
so after lot of convincing F is still not going to
Talk to anyone about this.
So i have decided ill write an anonymous email to HR, the manager and other senior people in the organisation about whats happening.
I really dont know how itll go. Ill keep updating you guys. Feel free to share ur thoughts.2 -
Since ive started college my will to program has become non-existant. Im a self taught programmer since 12, it used to be MY thing and i loved it. I used to spend hours a day just programming personal projects because i love it. However since college has been getting serious with this being my junior year and having part-time contract work i dont "love it" as much. Im a little scared, i have no time to just code for fun and when i do have time it feels like work because thats the only other time i code.
What should i do guys, i dont want to fall out of love with programming, it's part of who i am and i can feel im losing it.1 -
So are there WhatsApp users who now also would want to migrate after the new terms & conditions to something like Signal, but know that nobody in their contacts will probably migrate as well?
I hate it that you're basically forced to stay on WhatsApp because everybody (at least for me) is using it and 90% of the users probably don't care.
Im gonna try and see whether or not I can 50/50 them, but I'm scared that WhatsApp is simply too big to have people transition... Using it as a safer sms app is quite useless because well, it's basic sms and nobody in my direct contact circles uses texts (neither do I want to do that tbh).21 -
I love developing apps and software but im scared becoming a dev by profession will ruin the experience for me and drain my soul1
-
I think Im subconsciously planning my suicide. I already abandoned close relatives and friends. I refuse to work or apply for Jobs. I am lazy and spontaneous. Im back on drugs. I take unnecessary risks. Time is moving fast but slow at the same time. I’m fine with the monotony of slipping down into a deeper hole. I don’t know what hope is. Some days I don’t eat at all or get out of bed. I even started confessing my feelings to people I love but have been scared of. I feel that there is nothing left to do but get rid of this alive feeling and reality as I know it. And related to all of this, I feel apathetic and bored.8
-
Dear Windows, we have to talk. I love you, you know that, and I know that your market share has been shrinking in recent years and you're shit scared of becoming irrelevant but for the love of god:
- STOP asking me every god damn few weeks if I want to change my browser settings - NO I FUCKING DONT WANT TO USE BING, FUCK OFF
- STOP trying to be like an app and add pointless new "features" that nobody cares about and just do your fucking job, which is to be a PLATFORM which is stable, never changes and that gets out of my fucking way
- STOP reinstalling apps I uninstall, Im NOT FUCKING INTERESTED IN PAINT 3D, FUCK OFF
FUCK, ME,2 -
So im new here and trying to find my way. There is one colleague who's been sick for a couple of days and just came back.
Note on the appearence of this person: big, tattooed bearded, but im not scared easily ;)
Trying to introduce myself: "Hi, let's shake hands: i'm [name]"
Colleague: "Are you sure about that?"
Yeah. Great week with awkard interactions so far!4 -
I posted two of my projects a few days ago to producthunt one did very well and what came out of it is i got offered a fulltime job in my town.
That will be my first job if i pass their test im doing tomorrow and Im scared beyond shittless. Not from test but from the whole experience. All of it happened too fast. Im starting to doubt myself now. And once again scared shittless. Fuck you brain!2 -
my employer moved our company to the UAE. we were in a dying and collapsing country. Now we are in a stable and great place to be. We are even paid about double the average salary here.
But...
He now seems to believe we all owe him. so every time a long weekend / holiday comes up he tells us you have a week to deliver X or ur career will be in danger.
I have been living the past 2 months with those continuous threats. In utter anxiety over possibly losing a job i love because of him.
Before the weekend started he tagged us and said you have 48 hours to fix X. and here i am on a weekend working 10 hours a day as a result.
But i have been pulling 2 day shifts in one day. spending nights, weekends and holidays working on the project he wants fixed. and he still seems very angry at me and my team all the time. very unappreciative. and just very hurtful.
im just scared shitless because i have a family i support and have Just moved to a new country and paid thousands of dollars to rent and furnish my new place. If i get fired now i would be ruined...3 -
i started smoking cigarettes 1 year ago. and its getting more intense. i only smoke when i am overburned with HEAVY. HEAVY FUCKING STRESS.
11 august 2024 i had a mental breakdown. complete crashout due to losing ANOTHER 2000$ on $VINE coin
i crashed out so hard. so badly. in front of my parents. dad picked me up from floor and hugged me and he was shaking. mom was comforting me confused and scared. i uncontrollably breathed hard shaked and cried.
thats why i started.
crypto was the trigger to start smoking for the first time ever after 27 years.
now 28 years later i am still smoking but very rarely. took me 1 year to smoke 1 pack of cigs. now im on a 2nd pack.
i smoke 2-4 cigs per session one after another.
am i fucking going insane?4 -
i wanna be happy but i think im afraid of being happy, because being sad and alone is sort of comfortable at this point, since im like this since a long time ago. i still feel hurt bcs i feel so alone and i feel like a loser but im able to find distractions so i dont have to deal with all this guilt and sadness, but when things start working out in my life i keep thinking "do i deserve this?" and i get scared and really ashamed. scared of what people will think of me, scared of what they will do to me, ashamed of what people will and do think of me, so i just end up isolating myself all over again and being alone and sad and depressed all over again as well1
-
The Youth
How is the youth?
Pretty good question we don´t really like to communicate to older people well actually most of us have a mental issue, I know it´s kind of sad but when life gives you lemons you use them to make girls cry and that our way of thinking “I´m gonna die anyways lrts do something epic” cuz we aren't afraid to talt to the president of the united states of America like this but we are to scared to order mcdonalts of our self. I mean it´s a aspect that everyone knows we don´t know that person could be a murder of maybe that´s a little to over the top but like we just don´t like it OK.
You may ask what dose she mean with mental health issues?
Well we all know the good old depression its just that we life in a world in that you have to be perfect and when you are´t than you are a disappointment your parents want you to be a doctor or lawyer or something like that because it´s a well payed job but your generation wants to be creative we need our space to crate need things and do something amazing but this world is just a weird place were everyone has to be perfect and follow a ideal. Your appearance dosen´t describes how you are not everyone that has tattoos is a criminal or dose drugs nobody talks about the real problems.
What are the real problems?
Let me tell you we life in a world were nobody talks abou suicide nobody want´s to hear about it let me tell a fact.
Every 40 seconds somebody dies because of suicide.
Suicide is like a terror act when you were close to that person you got completely destroyed if you were far away than you got hurt but not as bad as the persons who were close. But nobody talks about this because it´s not “normal” that makes the persons who need help not reach out because they think its´s not okay.Stop the silence and help :)
But how dose it feel to have depression?
Well you can describe it as this:
it´s as you would lock yourself in a room with just a window but that window dose not have a handle but a curtain that closes every day a little more until there is no light anymore and the first days after that happens you will be scared and lonely and it will hunt you down but depressed people have to life like this every day and it becomes a normal state of mind until they decide they aren´t worth living anymore and they try to kill themselves. It hurts to see all those people die but it is the truth and truth is´t always fun.
Why am I writing this?
Honestly im asking myself that but it just feels right to tell wahts in my mind because a lot of people feel like they are tongue tied and can´t say what they are thinking and feeling and don´t express themselves. And also in my head is a lot wrong but at least I feel like I am doing something while writing this. I am one of the generation Z and I am proud that our generation has all this strength to fight for LGBT+ community and the black life's and I am proud that we understood that all this community's have to be respected because all people are on this earth and we all have to survive somehow and it dose not matter what skin color you have or sexual orientation.
But these are just my thoughts I hope everyone is doing well druing these times.
And to everyone I am proud of you and I love you.4 -
I read about wasm and being a web dev Im now scared.
So I want o learn c++. Even if not for wasm it would still be really cool to have that language in my toolbox.
Any recommendations where to start?6 -
I hardly run into weird bugs at work anymore, im scared that i might stopped progressing as a programmer.1
-
I just accepted a project for a high budget but i never did something on that big of a scale. I have the budget to consult with experts if i need them but in just feeling insecure about it.
at the same time i want to take it so i add it to my portfolio and i believe i can overcome any obstacle im just a bit scared
is that normal, any advice?1


