Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "just kill it"
-
Another day, another hit piece against gaming.
So, a 15-year old boy hanged himself and the media goes all „This was caused by this game“, even though NO FUCKING TRACES OF THE GAME WERE FOUND ON THE LAPTOP OF THE DECEASED!!!
And then of course my freaking parents go all lecturing me about how the internet twists the brain into not being adequate towards reality etc.
First off, CAN THE FUCKING COLLECTION OF COCKSUCKERS that is the fucking media just fucking get a grip on reality? It was literally said in the same sentence that the supposed game that caused that was not found in any form on the person's laptop. You would think an online game that you take months to play through would need at least some fucking download to run, right? Unless it was a freaking video chat bullshit that they call a „game“ just for the fucking spite of gamers.
Second, HOW FUCKING LONG WILL IT FUCKING TAKE FOR PEOPLE TO FUCKING ACCEPT THAT IT'S NOT THE TECH THAT MAKES PEOPLE KILL THEMSELVES? How hard is it to fucking understand?
Third... How do people in their 60s freaking think they understand anything about modern gaming when they have no freaking way of interacting with it other than these hit pieces? They certainly give more fucks about what a hired bitch of a lying „journalist“, that cannot even talk properly, says. Oh, they care so much about the children. Have they never thought that people are killing themselves exactly because they feel nobody cares about them?
Fourth. How fucking long do parents like mine deny the reality that just as long as they see me as an incomplete copy of my sisters I will be suicidal? Let me guess... It's video games causing me to be oh, so inadequate when I've not played any of them for quite some time...
Fifth... How am I out of touch with reality when these people have never known how I „work“, so to speak, as a person, and they've been the ones basically dictating all my life? Let me see why I'm unhappy...
I know I complain a lot. Sorry for that. But I just cannot stand people like them. People that lie all the time and project that on you while depriving you of any means of defending yourself in a debate...40 -
IF PROGRAMMING LANGUAGES WERE DRUGS:
JavaScript = Methamphetamine:
Anyone can cook some up at home but only pros can make the good stuff without blowing everything up.
Under the influence it tries to do everything at once, in seemingly no specific order before running off and making plenty of promises - but you have no clue if it kept any until it returns.
C = Heroin:
It takes some prep before you can take a hit but when you do it's far more potent than expected. When prepped (compiled) correctly it will induce complete and utter ecstasy but any error or abuse may kill you, leave you on the floor, in a coma or wishing you were dead.
HTML = Paracetamol(Panado):
Some don't think it's a real drug and others do. Either way you should grow a pair and try something a little more hardcore.
--------------------------------------
I came up with these after I randomly explained asynchronous js to a junior as synchronous code on meth. These were just off the top of my head, please feel free to correct or expand on them :-)24 -
Sorry, !dev-related.
Today I wake up tired. Mother barges into my room and tells me I should be already ready, takes time to fucking argue, then does some cleaning(As if I never do it or something), and this evening she starts arguing about that again and just disconnects the plug from my PC, telling me I shouldn't have gotten a person who takes preparing way longer than me and who also got out of the car when I was ready to take off late AND that I should apologise to her for speaking „in a rude manner“, when just a few seconds ago from that she hit me. That hit wasn't painful. It still was a hit, though. Do I have to say how angry I got? As if I needed that. I'm already having trouble with not wanting to kill myself for a whole week nonstop. And she tells me I have to apologise or I don't get my PC back. Oh, I haven't gotten to the best part: My birthday's coming really soon. A week and a day later. Beats me how I will have to force myself to smile like an idiot again just because the actual idiots cannot understand the shit they've done to my mind. So much so I may not be functioning at all if I stay with them much longer.
This combined with all my family telling me how insane I supposedly am etc.
I might try a photography school. My friend(who could be my twin), has been nagging me about trying it...
I need a job.
I need a fucking place away from these blood-sucking leeches.
I need to understand how my horrible self-esteem has potentially fucked my whole life up and how much nerves I wasted on my goddamn nuclear family.
I also need to learn to forgive myself.
Many more, but I will end this here.39 -
woke up at 5am
no alarm clock was required
my fucking passion woke me up to get up and code.
i coded outside in my backyard
felt like cold war
it was night
it was dark
a depressing horror atmosphere
just like my whole life
2 hours later i started seeing sun
it was cold outside. alone. in the dark. my arms were freezing.
but 2 hours later i managed to code the feature. it worked.
3 hours have passed. im ripped. quentally.
doing it here. inside now. started the day happy. dropped bullshit from day before. cleanser of all toxicss.
fuck the past. the past will pull you down and kill you.
this. remember. always do not forget.7 -
I actually hate this job, seems like there's not a single project with decent code abstraction. Everything is a fucking spaghetti like:
```
// we only care about e-mail fields, which are odd
isValid(index) {
if(!(index%2)) {
return true;
}
...
}
```
Like MOTHERFUCKER, WHAT BUSINESS RULE DOES THIS SHITCODE REFLECTS?!?! WHY CAN'T YOU SHITHEADS WRITE PROPER BUSINESS ABSTRACTION RATHER THAN JUST COLLEGE-GRADUATE QUALITY SHITCODE.
FUCKING KILL ME ALREADY I SHOULD HAVE INSTEAD BECAME A PSYCHIC CAUSE I'M SURELY GOOD AT GUESSING WHAT THE FUCKING FUCK THIS FUCKING FUCKCODE INTENDS TO ACHIEVE.
AND YOU CALL YOURSELF TOP-NOTCH DEV CAUSE THIS IS JAVASCRIPT... YOU KNOW WHAT, SHITHEADS LIKE YOU, WHO DON'T KNOW SHIT OTHER THAN GLOBALLING EVERY FUCKING NPM LOCAL PACKAGE IS WHY GOOD ENGINEER LIKE US GET SHIT FROM PHPEPSI ZENDFRAMESHIT FUCKHEADS DEVS.
DO YOU THINK YOUR COMMENT WAS HELPFUL??? DO I LOOK LIKE A BUSINESS GRADUATE FUCKTARD WHO DOESN'T KNOW WHAT THE FUCK THE MODULE OPERATOR IS??? I WANT TO KNOW WHY YOU WROTE THAT SHITFUCK INSTEAD OF WHAT IT DOES; THE REASON I'M READING YOUR POORLY WRITTEN MODULE OPERATOR SOAP-OPERA IN THE FIRST PLACE IS CAUSE I KNOW WHAT IT'S DOING, IT'S BREAKING SHIT.
OH AND ONE MORE THING, FUCK YOU FUCK FUCK FUCKSHIT SHITFUCK FUCk11 -
If programming languages where weapons...
1. C is an M1 Garand standard issue rifle, old but reliable.
2. C++ is a set of nunchuks, powerful and impressive when wielded but takes many years of pain to master and often you probably wish you were using something else.
3. Perl is a molotov cocktail, it was probably useful once, but few people use it
4. Java is a belt fed 240G automatic weapon where sometimes the belt has rounds, sometimes it doesn’t, and when it doesn’t during firing you get an NullPointerException, the gun explodes and you die.
5. Scala is a variant of the 240G Java, except the training manual is written in an incomprehensible dialect which many suspect is just gibberish.
6. JavaScript is a sword without a hilt.
7. Go is the custom made “if err != nil” starter pistol and after each shot you must check to make sure it actually shot. Also it shoots tabs instead of blanks.
8. Rust is a 3d printed gun. It may work some day.
9. bash is a cursed hammer, when wielded everything looks like a nail, especially your thumb.
10. Python is the “v2/v3” double barrel shotgun, only one barrel will shoot at a time, and you never end up shooting the recommended one. Also I probably should have used a line tool to draw that.
11. Ruby is a ruby encrusted sword, it is usually only used because of how shiny it is.
12. PHP is a hose, you usually plug one end into a car exhaust, and the other you stick in through a window and then you sit in the car and turn the engine on.
13. Mathematica is a low earth orbit projectile cannon, it could probably do amazing things if only anyone could actually afford one.
14. C# is a powerful laser rifle strapped to a donkey, when taken off the donkey the laser doesn’t seem to work as well.
15. Prolog is an AI weapon, you tell it what to do, which it does but then it also builds some terminators to go back in time and kill your mom
All credits go to Vicky from damnet.com5 -
Are you for real Guido/python devs?! Can we stop shoving politics into non issues just to virtue signal please?
What the fuck is next?! Oh you can't kill a process you politely put it to sleep, you can't call that machine a server anymore it might get offended now it's called a service caring electrical appliance, hey what about removing python all together after all python could be misconstrued as phallic and drive women away; I know! Let's call it Santa/elves instead of master/slave!
Fuck off! And what's that of you being akward saying server/slave terminology around black people? That's insanely racist! Who the fuck thinks all black people are descendants of slaves? Why the fuck are you racist enough to imply they can't do their job properly because (unlike you) they would be uncomfortable, you low expectations racist fuck!
You just fucked with your open source base and I really don't wanna see python going woke and then broke.
https://github.com/python/cpython/...31 -
I have to let it out. It's been brewing for years now.
Why does MySQL still exist?
Really, WHY?!
It was lousy as hell 8 years ago, and since then it hasn't changed one bit. Why do people use it?
First off, it doesn't conform to standards, allowing you to aggregate without explicitly grouping, in which case you get god knows what type of shit in there, and then everybody asks why the numbers are so weird.
Second... it's $(CURRENT_YEAR) for fucks sake! This is the time of large data sets and complex requirements from those data sets. Just an hour through SO will show you dozens of poor people trying to do with MySQL what MySQL just can't do because it's stupid.
Recursion? 4 lines in any other large RDBMS, and tough luck in MySQL. So what next? Are you supposed to use Lemograph alongside MySQL just because you don't know that PostgreSQL is free and super fast?
Window functions to mix rows and do neat stuff? Naaah, who the hell needs that, right? Who needs to find the products ordered by the customer with the biggest order anyway? Oh you need that actually? Well you should write 3-4 queries, nest them in an incredibly fucked up way, summon a demon and feed it the first menstrual blood of your virgin daughter.
There used to be some excuses in the past "but but but, shared hosting only has MySQL". Which was wrong by the way. This was true only for big hosting names, and for people who didn't bother searching for alternatives. And now it's even better, since VPS and PaaS solutions are now available at prices lower than shared hosting, which give you better speed, performance and stability than shared hosting ever did.
"But but but Wordpress uses MySQL" - well then kill it! There are other platforms out there, that aren't just outrageously horrible on the inside and outside. Wordpress is crap, and work on it pays crap. Learn Laravel, Symfony, Zend, or even Drupal. You'll be able to create much more value than those shitty Wordpress sites that nobody ever visits or pay money on.
"But but but my client wants some static pages presented beside their online shop" - so why use Wordpress then? Static pages are static pages. Whip up a basic MVC set-up in literally any framework out there, avoid MySQL, include a basic ACL package for that framework, create a controller where you add a CKEditor to edit page content, and stick a nice template from themeforest for that page and be done with that shit! Save the mock-up for later use if you do that stuff often. Or if you're lazy to even do that, then take up Drupal.
But sure, this is going a bit over the scope. I actually don't care where you insert content for your few pages. It can be a JSON file for all I care. But if I catch you doing an e-commerce solution, or anything else than just text storage, on MySQL, I'll literally start re-assessing your ability to think rationally.11 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
I wonder if those people who give unwarranted useless advice to developers go to their doctors and do the same thing.
- Doc, just make a small slit, take out old heart, put in a new one, connect everything back as before and stitch it. Easy peasy. Shouldn't take more than a few minutes.
- my leg is fractured. Just open it and tape it back. It is a hack job, but it'll make the client happy for now. It will be quickly done.
- I think I have cancer. Just write a script to kill it. Shouldn't be too difficult.
Fuckers.4 -
Stop it with the Linux shilling already.
I'm 27 years old and I love Linux and git and vim just as much as the next guy (yeah fuck you emacs!). I have discovered this place as a room for discussion, advise, humor and rants of course, and I had my good share of giggles.
But lately it seems that every other Post is "look at me I installed Linux" or "hurr durr he doesn't use git" or "windows omfg kill it with fire". And to some degree, those rants have a good point and are absolutely right. However, most of them are not.
This is why you're part of the problem. Constantly shaming and ridiculing any technology that's not hip in nerd culture, regardless of the circumstances. This makes you look just as bad as the peoples you look down upon for writing their code in notepad++ on windows xp with McAfee installed. Even worse, from a professional point of view, it absolutely voids your credibility.
How am I to take you seriously and presume a fair amount of experience and out of the box thinking if all you do is repeat catchphrases and ride the fucking hype train. And yes, I know there are a lot of minors or peoples who are just getting started in the industry. But I have seen enough self-righteous hateful spews from peoples who claim not to be.
Anyway, this is getting long and I think I have made my point. Maybe I am just too old to be joking around that shit all the time anymore. But from what I have seen, I wouldn't hire the biggest part of you. Not because you are bad at what you're doing, but because what you say makes you look absolutely unprofessional.
But then again, this is devrant and I love you all. Have a great week everyone!21 -
So, I just got up, opened my sister's laptop to work (she gave it to me while I was in this small trip) and I see this. She was like "if you break it, I'm gonna kill you" and I said "oh no! What am I gonna do? Hammer it or something?" Fuck my luck, seriously16
-
A quite normal Windows day:
Bios to Windows: "Go now! Get up!"
Windows to Bios: "Always slow with the young circuit boards."
"I've got something weird on screen."
Windows' answer: "Ignore it first."
Hardware assistant to Windows: "The user puts pressure. He wants me to identify this thing. Could be an ISDN card."
Windows: "Well, well."
Unknown ISDN card to all: "Will you please let me in?"
Network card to intruder: "You can't spread out here!"
Windows: "Quiet in the case! Or I'll cut both their support!"
Device Manager: "Offer compromise. The network card is allowed on Mondays, the ISDN card is on Tuesday."
Graphics card to Windows: "My driver retired yesterday. I'm crashing now."
Windows to graphics card: "When will you be back?"
Graphics card: "Well, not at first."
CD-Rom drive to Windows: "uh, I would have a new driver here..."
Windows: "What's ich´n supposed to do with it?!"
Installation software to Windows: "Leave it, I'll mach´ that already."
Windows: "That's nice to hear."
USB connection to interrupt management: "Alarm! Just been penetrated by a scanner cable. Request response."
Interrupt management: "Where are you coming from?"
USB connection: "I was in the computer right from the start. I'm joined by another colleague."
"You're not on my list." - "Say something."
Windows: "Hopefully there won't be another printer."
Graphics card: "The new driver twitches."
Windows: "We'll just have to get the old one out of retirement."
Uninstall program to new driver: "Go away."
Unwanted driver: "Fuck you."
Windows to Norton Utilities: "Kill him and his brood!"
Utilities to driver rests: "Sorry, we have to delete you."
Important system file: "Arrrrrrgghh!"
Windows on blue screen: "Gib´, the Norton Boys are over the top again."
Blue screen to user: "So, that's it for this week."
Excuse me for stealing your time
And I know it's way too long7 -
fork() can fail: this is important
Ah, fork(). The way processes make more processes. Well, one of them, anyway. It seems I have another story to tell about it.
It can fail. Got that? Are you taking this seriously? You should. fork can fail. Just like malloc, it can fail. Neither of them fail often, but when they do, you can't just ignore it. You have to do something intelligent about it.
People seem to know that fork will return 0 if you're the child and some positive number if you're the parent -- that number is the child's pid. They sock this number away and then use it later.
Guess what happens when you don't test for failure? Yep, that's right, you probably treat "-1" (fork's error result) as a pid.
That's the beginning of the pain. The true pain comes later when it's time to send a signal. Maybe you want to shut down a child process.
Do you kill(pid, signal)? Maybe you do kill(pid, 9).
Do you know what happens when pid is -1? You really should. It's Important. Yes, with a capital I.
...
...
...
Here, I'll paste from the kill(2) man page on my Linux box.
If pid equals -1, then sig is sent to every process for which the calling process has permission to send signals, except for process 1 (init), ...
See that? Killing "pid -1" is equivalent to massacring every other process you are permitted to signal. If you're root, that's probably everything. You live and init lives, but that's it. Everything else is gone gone gone.
Do you have code which manages processes? Have you ever found a machine totally dead except for the text console getty/login (which are respawned by init, naturally) and the process manager? Did you blame the oomkiller in the kernel?
It might not be the guilty party here. Go see if you killed -1.
Unix: just enough potholes and bear traps to keep an entire valley going.
Source: https://rachelbythebay.com/w/2014/...12 -
Well today I got a fantastic surprise (truthfully). We hired a dev some months ago, who was on 6 months probation and, to put it politely, he was not going to pass it.
*side note: for details of some of the above, read my last 10 or so rants. They are pretty much all him.
Anyway, management put him on an improvement plan to make sure everything was fair, it wasn't working out, but they said we had to finish it to be fair.
So we had another 2 weeks left when he announced last night he's leaving for a new junior role, technical but not a dev.
Months of stress, heartache, bewilderment, late nights and weekends all just came to an end.
The English language fails me to express my overwhelming joy at this moment. The only way I can come close to it is to say that when he made his announcement, a colleague told me I should stop smiling as it could be taken as being rude.
I'd like to take this moment to thank the community for supporting me over the past few difficult months. Without you I probably would have tried to kill him with my dev rant stressball.
Thanks,
practiseSafeHex8 -
🙁
Every girlfriend I had broke up with me and it was not even my fault...
1. A bi cheating on her girlfriend - girlfriend found out
2. Furry cheating on her boyfriend - she felt bad...
3. Hysteric b** that did not trust me for even 1 second
4. Really nice and sweet girl... that could kill me if she did not take her antipsychotics - told me she is sorry but she wants someone older (I am older than her...) - her ex before me was 42....
To clarify: both 1 and 2 did not tell me they were cheating on someone with me... I only found out after the shit hit the fan.
I feel depressed... I just want to love someone and I want that someone to love me... that's it, I don't even want sex, I just want hugs, mutual trust and someone that I could tell anything on my mind without them judging me...30 -
As I was walking to the store, I found yet another piece of evidence of nature rape (aka fucking nature by littering of harmful substances). Just like last time I brought it home for proper disposal.
But if I ever find the motherfucker who did this, I have a nice punishment for you. I'll knock you unconscious, drag you home, take your phone and desolder its battery. Then I'll strap a plastic bag around your stupid face, and put the battery in there while it's being shorted. Quickly it'll heat up and you'll start to turn blue with that little bag being your only oxygen source. And when that battery puffs, boy are you going to fucking gasp it all in. Hopefully that'll be poisonous enough to kill you on the spot. If not, I'll have some fun watching you die from oxygen deprivation. Or I'll jam that very same AA battery that you dropped down your throat - you choose.
Call me a psycho all you want, but what does that make you, whoever attempted to further fuck nature by uncaringly dropping a battery on the sidewalk? Oh and let's not mention the results of it - a heatwave that's been going on for over a month now. Thank you so much for bringing the place that you deserve to be in - hell!rant nature rapists fsociety fuck society uncaring motherfuckers fuck it all fuck humans fuck humanity13 -
Friend of mine killed his MacBook with some Softdrink.
Just poured it all over his poor a1502.
He let it dry for a few days, it starts to work again.
Except the battery.
Goes on Amazon and buys a new battery.
New battery doesn't work either and so he tells me about it and I as stupid as I am couldn't resist the temptation to finally work on a MacBook like my "hero" Lois Rossmann does.
So turns out the board is good.
Cleaned it up and basically nothing happened to it.
So what's the deal with "los batlerias"?
The first got hit by liquid, the second had a broken connection to a cell.
That could have happened through my friend, installing it without testing it first, or at the seller, so it being a DOA battery.
Now away from the stupidity of my friend and the situation to the actual source for this rant.
Once something happens to a modern Managed battery, the Battery Management System (BMS) disconnects the voltage from the system and goes into an error state, staying there and not powering anything ever again.
For noobs, it's dead. Buy a new one.
But It can be reset, depending you know how to, and which passwords were set at the factory.
Yes, the common Texas instruments BQ20Zxx chips have default passwords, and apple seems to leav them at default.
The Usb to SMBus adaptors arrived a few days ago and I went to prod the BMS.
There is a very nice available for Windows called BE2works, that I used the demo of to go in and figure out stuff. The full version supports password cracking, the demo not.
After some time figuring out how Smart Battery Systems (SBS) "API" works, I got to actually enter the passwords into the battery to try get into manufacturer and full access mode.
Just to realise, they don't unlock the BMS.
So, to conclude, my friend bought a "new" battery that was most likely cut out of a used / dead macbook, which reports 3000mah as fully charged instead of the 6xxx mah that it should have, with 0 cycles and 0hours used.
And non default access.
This screams after those motherfuckers scaming the shit out of people on Amazon, with refurb, reset, and locked fucken batteries.
I could kill those people right now.
Last but not least,
My friend theoretically can't send it back because I opened the battery to fix the broken connection.
Though maybe, it'll get send back anyway, with some suprise in the package.9 -
Dear senior developer with xx years of development experience, please, I BEG OF YOU hear my humble unprofessional opinion.
Not every junior is a inexperienced low life.
Even though I'm glad that I'm working with someone of your wide skill set and expertise, I'm not working with you by choice nor it is my intention to distract or "steal" your knowledge.
When I suggested using a newer version of jQuery for this new project that didn't mean I'm challenging you to work on something new for your domain, I'm merely suggesting this change because jQuery 1.2 is just old and a big portion of it is deprecated.
When I suggest some changes on your CSS selectors that doesn't mean I'm acting out of place, it is my genuine interest of having effecient css where possible.
I know you (in your opinion) are the best full stack developer in the industry, but maaaan you kill me when you use js and regex to validate input type=email (table filp) ... Haalllloooo it's 2017 this Sunday aren't we supposed to progress instead of remaining in the same old same ?
RANT!!!8 -
Note to self: never ever touch the bugzapper that's busy zapping a mosquito! Always remember that there's well over a 1000 volts on there regardless of its power rating. Anything over 50V can kill you!
.. if only my drunken fool self would realize that. Seriously though.. the kick of a bugzapper's shock, it's amazing! Just like drugs however, don't try it at home. Oh well. At least not me but yet another mosquito has bitten the duster. Serves those parasitic bitches right!!!23 -
Wtf, really??? Are they trying to liyerally KILL ME????
Got home from hospital today wth my family. Baby got sick. Wife also caught cold... Bad news. It was just me still healthy like a raddish [we have such saying].
So I got home. Started feeling somewhat funny. Sore thighs, feeling nauseaus, chilly, a bit dizzy.
10 minutes later I'm fucking trembling! It felt as of I was kicked put bare ass to -20C outside! I'm not exaggerating [probably made some typos.. Pls correct me] - i live where winters get like -35C. Everything around got like twice darker. And my lower teeth got itchy af [NOT the best feeling, trust me].
I must have caught cold too - I thought to myself, cuz I know what these sympthoms mean. I always have 'em all when I have fever. Since shivers are caused by rising fever I got my Microlife remote thermometer out of my drawer. Click, blue light, wait, beeep. 36.5C. Allright.. Maybe I got it wrong... Try again -- same result. Wife also gave a couple tries - nada. Nil. Nullpointerexception. Healthy like a pickle!
10 minutes later I couldn't stand the cold. Got under my blankets wife made some soup, tea,... I still have this analog thermometer, the one with quicksilver. Pop it into my armpit - jusyt in case. 10minutes later I take it out. It says 39,5 and rising. Try the microlife again. 36,5. WHAT THE FUCK?????????
If I weren't so fond of old-school stuff I'd be in a fucking ER now!!
Fuck you medical digital equipment made to be used at home! FUCK YOU!!
I'm pissed.
Do you folks kbow where could I get those q-silver thermometers? Just in case. They're already out of matket in my area for quite some time... For being dangerous [i give 'em that, okay?] and.... Lisen to this.... "unreliable"!
FUCK IT!15 -
When the entire platform mysteriously goes down for a half hour at 11pm ON A SATURDAY AND YOU'RE THE ONLY PERSON WHO WORKS ON IT GOOD GOD SERIOUSLY YOU'VE GOT TO BE SHITTING ME I JUST WANT TO SLEEP
WHOEVER DID THIS I WILL FIND YOU AND I WILL KILL YOU3 -
Years ago, when i was a teenager (13,14 or smth) and internet at home was a very uncommon thing, there was that places where ppl can play lan games, have a beer (or coke) and have fun (spacenet internet cafe). It was like 1€ per hour to get a pc. Os was win98, if you just cancel the boot progress (reset button) to get an error boot menu, and then into the dos mode "edit c:/windows/win.ini" and remove theyr client startup setting from there, than u could use the pc for free. How much hours we spend there...
The more fun thing where the open network config, without the client running i could access all computers c drives (they was just shared i think so admin have it easy) was fun to locate the counter strike 1.6 control settings of other players. And bind the w key to "kill"... Round begins and you hear alot ppl raging. I could even acess the server settings of unreal tournament and fck up the gravity and such things. Good old time, the only game i played fair was broodwar and d3 lod5 -
HOW TO KILL A DEVELOPER
Coworker: Hey, is http://website down for you?
Me: yeah. What's up?
Coworker: Ah, that explains why my tests are failing.
Me, internally fuming: It would be good test practice to not depend directly on external services.
Coworker: I know, but this is easier.
This makes my blood boil. I'm not a huge fan of mocking and stubbing everything, but when it's actually very easy to mock something and you're too lazy, that makes me fucking angry.
Remember kids: doing it right takes longer than doing it wrong. But doing it wrong will eventually take significantly more of your time. Just wait until your shitty assumptions fail and you don't have any recourse.6 -
The ultimate "I am vegan" guy will be arch linux user, vegan, trans, crossfitter and cryptocurrency investor. I've just met guy like this in my job. He did not shut up for a while. I am not sure whats he doing and whats his job but my guess is that hes paid for spreading cancer, sucidal toughts and eatig your will to live and talk with people...
R - retard
M - me
R: Hey CopyPasteCode I found this bug, it does 'this' insted of 'this'. *spreads arms to see his "muscles"*
M: *headphones off* Ok, I will look into it... *headphones back on*
R: Btw you invested something in the crypto, didnt you? Ive invested... ...bitcoin... ...crypto... ...litecoin..., do you think that... ...something... ...bla bla bla?
M: *tries not to kill myself after his 5 minutes of monolog* Ye sure
R: By the way Ive found this awesome vegan restaurant that accepts litecoin, would you like to come sometime?
M: *10 minutes monolog about vegan food and shit. At this point I want to die* Ok, I will now work on that back, see you later.
R: ye sure bro (wtf, "bro"?)... *looks like hes walking away* *teleports on my otger side touching my monitor*
WOW you are also a Limux user? 😮 Ivr installed arch linux this weekand and its so awesome, *another 6 minutes of monolog*
M: *smiling and preparing to kill him or myself* Nice, awesome *fake smile*
R: Anyway, I gotta go (FINALLY!!!), btw, I am going to the *name of local trans and gay club*, wanna go with me?
M: *after a month after a breakup with my GF (because she was cheating on me) which everyone in the office knew...)* Not really *trying to thing how to say "fuck off" without having meeting with HR*, I cant, I already have somethimg.
R: Oh, ok. Btw, you are rly cool bro (again), we should hang. We should hangout more often...
I hope someone is paying me for loosing 27 minutes with this guy.14 -
If you need to learn/teach object orientation, these are my approaches (I hate that classic "car" example):
1) Keep in mind games like Warcraft, Starcraft, Civilization, Age of Empires (yes, I am old school). They are a good example of having classes to use, instantiating objects (creatures) and putting them to work together. As in a real system.
2) Think of your program as an office that has a job to do, or a factory that has something to deliver. Classes are the roles/jobs and objects are the workers/employees. They don't need to be complex, but their purpose must be really (really, really) well defined. Just like in a real office / factory.
3) Even better (or crazier), see your classes and objects as real beings, digital creatures in a abstract world, and yourself as a kind of god, who creates species (define classes) with wisdom. Give life when it is the time for them to come into the world (instantiate object) and kill them when they are done with their mission (dispose an object). Give them behavior, logic, conditions to work with, situations where they take action, and when they don't. Make them kinda "smart". Build them able to make decisions and take actions based on conditions. Give them life. Think on your program as an ecossystem. There must be balance, connection, species must be well defined and creatures must work together to achieve a common objective. Don't just throw code and pray for it to run. Plan it.
-----
When I talk about my classes like they are real beings, and programs as mini-worlds, some people say I am crazy, some others say that's passion.
It is both! @__@3 -
Proprietary video format. Native iOS app. Ok.
Using swift to decode and render. Ok.
Kills battery and is actually too slow on older devices. Ok..
Diving into armv7 neon assembly, it puts the "ok" in "pleasure".. Ok.....
Getting it to work. Fast frames. Yes. Ok!
Battery still stressed..ok.
Just need to get rid of the brown tint.. ok.
The tint became a brand mark. iPhone gone. Ok! Hours later, received email.
Vendor upgraded to serve h264 over http.
"Kill yourself with fire, ok?"2 -
What's the difference between a wasp and single loose hair?
Apparently none till the wasp stings :/
Yesterday I thought I had a loose hair on my neck.. ok, I shrug it off.. later again the creepy feeling.. shrugs off..
I continue to work, sumberged in code, wanting to find the fucker (bug, not the wasp/hair).. lean in to the monitor... 10 cents away from the screen... Ok, maybe that's it! Feels the hair on my back, near shoulderblades again... shrugging again more violently to get it further down to fall out.. nothing.. ok, got the bug, threw myslef back in the chair with substential force & BAAAAM!!! Motherfucking hair bit me!! O.o
I scream in horror & on top of the lungs (it was late, after work hours so I didn't expect anyone else still at the office) PROKLETA PRASICA (roughly translated to goddamn female swine).. I previously saw some green bug flying around the office and I thought that nasty thing bit me (didn't know they bite soo, much more horror for me).. O.o
Anyhow, I jump up from the computer and see my coworker looking at me all baffled.. I proceed to franticly take of my headphones and hoodie..thinking about wtf should I do now, I cannot get undressed in front of him (not for my sake, bra is the same as top of the bathing suit for me, but still..I don't want anyone suing me for impropper behaviour of undreasing in front of coworkers..), how the fuck should I get to the toilet?! O.o
C: Are you ok?!
M: Um.. sth bit me..wtf?!
C: There was a wasp flying around somewhere some time ago.. are you alergic?!
M: um..not sure, I don't think so..we'll see soon..
I proceed to the WC, to take off tshirt & check/kill off the fucker.. on my way there (walking funny to not press the hair to my body again) I got another surprise, another coworker was working late..
C2: Are you ok?! O.o
M: yeah, sth bit me, probably a wasp..
Ok, finally on the loo..ok, do not lock self in in case it escapes and you need help.. don't even shut the door. Check.. standing between the doors I contemplate on how the fuck should I take my tshirt off without angering the fucker even more and getting bitten again.. O.O
I lifted the tshirt up my back to let it out.. nope, not there..the creepy felling of buzzing around between my shoulder blades continues.. crap.. what to do?!
I stood there & contemplated the task.. ok, roll up the tshirt to the shoulder blades, not against the body (duh) to prevent further stings..tighten the fabric, so it cannot escape, quickly remove the band from the body.. done..reversed the tshirt and straightened it.. bzzz... Fucker fell somewhere.. Dafaq?! Was it really just a wasp?! If yes, no problem...but what if coworker was wrong and I got bitten by that nasty green whateveritsname bug?! Eeeeewwww! Is it poisonous? Gotta find it & kill it for good.. waited a bit, than saw a goddamn wasp crawl from under the toilet.. wasp!! Yess!! Stopm stomp fucker!!
I get dressed & go back to my desk..
C: Did you terminate it?!
M: Yup, fucker went on a toilet paper trip down the drain!!
I sit down, starting to get my headphones back on and proceed to work.., but before I could, one last gem:
C: CTO would say, thank god it didn't sting you in your finger cuz you wouldn't be able to type anymore..
M: O.O so true hahhahahaaa
Disclaimer - I like animals, but I freakking hate wasps..especially if they get under my tshirt to sting.. :/7 -
WTF - I discovered that wasps listen to me!
Earlier when one came in, I tried to catch it with a glass and release it, or kill it if that wasn't feasible. This year, I tried pointing to the window and ordering "get out!" just because I was too lazy to take action. Of course, I didn't expect it to work, but it did. I thought it was only a coincidence, so I kept trying it. It works every single time!
Crazy shit!13 -
I jump on an existing scala project.
git pull && sbt compile test
Tests are failing.
Me: "Hey team, the tests are failing."
Team member: "That cannot be. They were passing for the the last run."
Me: "Did you run them locally?"
Team member: "No, on Jenkins. It was fine."
I check Jenkins.
Me: "What do you mean it's fine. The last successful deployment was on the end of May."
Team member: "The Pull Request checker always went through successfully."
I check how our Jenkins tasks are configured. It's true that the Pull Request Checker runs successfully yet due to a "minor misconfiguration" (aka "major fuckup") the Pull Request Checker only tests a tiny subset of the entire test suite.
Team members were were fine if their Pull Request got the "Success" notification on bitbucket's pull request page. And reviewers trusted that icon as well.
They never checked the master run of the Jenkins task. Where the tests were also failing for over a month.
I'm also highely confused how they did TDD. You know, writing a test first, making it green. (I hope they were just one specific test at a time assuming the others were green. The cynic in me assumes they outsourced running the tests to the Jenkins.)
Gnarf!
Team member having run the tests locally finally realizes: "The tests are broken. Gonna fix them."
Wow. Please, dear fellow developers: It does not kill you to run the entire test suite locally. Just do it. Treat the external test runners as a safety net. Yet always run the test suite locally first.4 -
AM I THE ONLY PERSON WHO READS THE CSS !important RULE AS ACTUALLY SAYING THAT SOMETHING IS _NOT_ IMPORTANT EVEN WHEN IT MEANS THAT IT _IS_?!!
Just kill me.7 -
Hello again, everyone. I've been busy with all the paperwork at my ship (will make a post about it later) but for now, I'll bore you with another story (not navy one, fortunately) to justify my slacking off.
And this story... is the story on how I got into ITSec. And it is pretty damn embarrassing. It all began when I was 16. I was hooked on battleknight.gameforge.com, a browser game. My father had just had ADSL installed at our home, and the new opportunities before me were endless. Well...
After I've had my fill with the porn torrents and them opportunities dwindled to just a few dozens, I began searching for free games, and I stumbled on that game. I played a lot, but as a free-to-play game, it was also pay-to-win. I didn't have a credit card, so I paid for a few gems with SMS messages. Fast forward a couple of years, I got into the Naval Academy. A guy came in to advertise something (I think it was an encyclopaedia or something - yes, wikipedia wasn't a thing back then) and to pay for it, we could apply for a credit card. So I applied. And I resisted the temptation for a year.
Note: prepaid wasn't that known where I live, so using credit cards was the only way for online transactions.
So I made 1 transaction. Just one. After a couple of months my monthly report from the bank came, showing a 2.5$ (I think) transaction on Paypal. I paid no mind, thinking that it was some hidden fee. Oh boy, I shit you not, I was THAT much of an idiot. Six months later, BOOM!
600$ transaction to ebay via paypal. You can imagine all those nice things that came to my mind. In any case, the bank accepted my protest that I filed at their central offices and cancelled the transaction. I promptly cancelled my card, destroyed it right there for good measure, and got to thinking... what the fuck just happened?
As many people here, I am afflicted with a deadly virus, called curiosity. I started researching the matter, trying to figure out how. And, because I didn't like black boxes and "it is just like it is" explanations, I tumbled down the rabbit hole of ITSec. I soon found out that, not only it was possible, but also it was sometimes EXTREMELY easy to steal credit card info. There are sites, to this very day, that store user info (along with credit cards info) IN FUCKING CLEARTEXT. Sometimes your personal, financial and even medical info are just an SQLi away.
So, I got very disillusioned on many things. But I never regretted it. It may cause me to age prematurely and will kill me of stroke or heart attack one day, but as I still tumble down the ITSec rabbit hole, I can say with confidence that
I REGRET NOTHING
Plus, my 600$ were returned, so look on the bright side :)1 -
Find a place where management is able to handle some criticism.
I personally think Agile/Scrum is holy, and I don't mean "yeah we kind of do our own version of it", no, fucking do it by the book. The PM shouldn't assign estimates. Developers shouldn't receive bugfix requests from anyone other than the scrum master. The CTO can't be your scrum master... etc.
If a company can't answer the question "What were the points of feedback during the last retrospective(s), and how are those points being picked up?" -- Don't work there.
Many other things are optional in my opinion. I could work at a company without QA, without fruit baskets, table tennis, without Friday drinks. I could even live without git & continuous integration, just emailing patches to a patch integrator. I don't care.
But maintaining a safe bubble of serenity and sanity for devs to do their work in, that is an absolute must.
Also, option to WFH as much as wanted. Offices are nice for social bonding, but they kill productivity for me.6 -
Fuck that bitch of a mother of mine. After what she's done to me, I would totally just fucking electrocute her (lawyers, this is a rage post not a real one, I've learnt from that previous psychiatrist that these rages can be taken improperly!) or just send a fucking EMP to her fucking "schermpkes" (EN: screens, displays, whatever! Technology!) or whatever. FUCK THAT FUCKING WHORE!!!
Yes she gave birth to me. Should I be thankful for that, in this world where for some fucking reason Flat Earthers still exist, Despastico and those goddamn fucking Paul brothers became a thing? FUCK NO!! I wish I wasn't born in the first place! Or rather, a thought that's been playing for a long time in my head. Why the fuck can't I just cryo myself and be reborn in the next millennium?! No, that's not possible because as it is now, humanity will likely have fucked up the planet by then. Majority of the people are still no more than self-jerking fucking monkeys. With their Instagram geotagging shit all over the place, nametests and shit like that. FUUUUUUUUUCKKKKKKKKK!!!!!!! Why are people like this?!!!! Why can't people be a tad more intelligent, why can't people actually learn about what this reality is all about?! Why is the burden of all this on scientists, no those who spoonfeed information into the mouths of the masses, like fucking Hashem Al-Ghaili (which is an amazing person but he's doing too much spoonfeeding IMO). WHY?!!! WHY AM I BORN IN THIS FUCKING DYSTOPIA?!!!!
WHY AM I BORN IN THIS FUCKING WORLD WHERE PEOPLE ARE INDOCTRINATED INTO "NOTHING TO HIDE, NOTHING TO FEAR"?!!!!! WHYYYYYYYYYYYYY?!!!!!!!! You've got a fucking brain, USE IT!!!!
I fucking hate this world. Someone hire a hitman on the darkweb to kill me and that fucking whore that gave birth to me, NOW!!!40 -
First of all, I hate crammers so much. These people kill the industry without even understanding it. They turned interviews into exams, missed the point of hiring, and saw no distinction between knowledge and information all the time. They don't understand that if you can google an answer in five seconds, it's not knowledge. It's information.
They don't understand that questions like 'what will Python do if you delete an item from a dict while iterating over it' are complete nonsense. They don't understand that it's not 'dig deep'; it's just a bad practice that leads to errors, thus must be avoided. The fact of remembering 'RuntimeError: dictionary changed size during iteration' means that you haven't been avoiding it enough.
One more example. Which signature is correct?
- ApplicationListener<ContextRefreshedEvent>
- ApplicationListener<ContextRefreshEvent>
- ApplicationListener<RefreshedEvent>
- ApplicationListener<RefreshEvent>
Second. What's the point of forcing you to write compilable code in google docs? Do they really expect that one could possibly remember 'import org.springframework.beans.factory.annotation.Autowired;'? Seriously?
Third. Why do they expect me to know Spark, Java, J2EE, Spring Boot, Python, Kafka, Postgres, React/Redux, TypeScript, and work for miserable 70K EUR?
What's wrong with the European IT job market? Are they fucking nuts?9 -
Shit! I knew buzzwords were overused, but I just saw an ad and it is fucking jesused jambled bananas in the ass.
Starts with a woman looking out the window and there’s a tornado (seems ok for now)
The tornado approaches and IT IS MADE OF FUCKING NON MONOSPACED IN MY ASS FONTED 0s AND 1s. Bonus point: they are green !!
Switches to lines of GREEN code (kill my fucking brain with a pistol attached to your dick right now)
Probably JS or something similar in syntax.
And then: A FUCKING GUY LEANING OVER POINTING SOMETHING ON THE SCREEN! HIS NAMETAG:
Logan Paul
Blockchain
👏👏👏👏
And then some other buzzing asses armagedon en d of the fucking world bleeding edge vibrator buzzwords shenanigans.
Finishes with drones shot flying between businesses building with 3d floating words like
Blockchain!
Artificial Intelligence
Deep learning
Etc.
KILLLLLL MMMEEEE FU748-KFJV ING 3I6HT N0W $)&(&($8#;&(&8 jeiebcrandom ad wtf prefer fake news for ads over that kill me right now why am i watching tv seriously buzzwords13 -
Today I saw a code written by my junior. Basically excel export. The laravel excel package provide great ways for optimization.
My junior instead did 6 times loop to modify the data before giving that data to the export package. We need to export around 50K users.
When I asking him why this ? He said it works and it's fast so what the issue ???
Noob , you have only 100 users in the database and production has 10 million.
Sometime I just want to kill him.15 -
I used to think Electron apps were gonna do great and make it more accessible for companies to produce high quality programs with ease.
Oh boy I was wrong. All it did is enable big companies with the ability to refactor all of their software to run 5 times slower, consume 10 times more memory and kill your battery 20 times faster.
I fucking hate all of this prototype fast optimize later bullshit. Can I get some value for my dollar? How come technology is just being degraded for the same of "ease of programming".
You save programming time but sacrifice end user time, cus our time just doesn't fucking matter.9 -
Shit morning, I work in tech, so I guess it is related haha.
First, I wake up and it is cold. Like -12 degrees Fahrenheit. With wind-chill, feels like -29 according to Google. Then, while getting ready for work, my only belt breaks. Not a little, but literally splits in half! Fucking sucks, as my pants keep partially falling down and my shirt keeps untucking.
I go out in this cold that could kill a polar bear, go to start my car. Can you fucking guess? Dead fucking battery. Fuck! Now I am super late to work.
Make it to work, and guess what? My manager just promised 100% completion by Friday, and we are weeks behind! Fucking sucks... I think my coworker snapped, as he keeps hyperventilating at his desk for no reason. Oh and our best coder just quit...
Waiting to either wreck my car or find out my dog is dead when I get home...4 -
> dockerized gitea stops working 502,
> other gitea with same config works just fine
> is the same config the issue? maybe the network names can't be the same?
> no
> any logs from the reverse proxy?
> no
> does it return anything at all on that port?
> no
> any logs inside the container?
> no
> maybe it logs to the wrong file?
> no others exist
> try to force custom log levels
> ignored
> try to kill the running pid
> it instantly restarts
> try to run a new instance with specifying the new config
> ignores config
> check if theres anything even listening
> nothing is listening on that port, but is listening in the other working gitea container
> try to destroy the container and force a fresh container
> still the same issue
> maybe the recent docker update broke it? try to make a new one and move only necessary
> mkdir gitea2
> all files seem necessary
> guess I'll try to move the same folder here
> it works
> it is exactly the same files as in gitea1, just that the folder name is different
>10 -
Okay, just wrote a program with memory allocation inside an accidental infinite loop and by the time I was able to kill it, it had already claimed 86% of my memory. Scared the shit out of me because my OS was CRAWLING for a while3
-
My worst experience is, that I was fired after the third week in a new job. I worked then for a really small company.
My supervisor didn't like me and just wanted me out.
He asked for feedback and new ideas. I provided good reviews.
I even gave the company really good ideas, didn't get any credits for it, but they have implemented them now. Never got any credit for it.
I can look back and say that my supervisor then was a douche and wanted to kill off a young guy with a bit more technical knowledge and a vision.
For me it's in the past...
Now I got a way better job at a really gigantic company, better pay, much better work with better working times, a very friendly and helpful team, which appreciate my feedback and effort.
Sometimes it needs to get worse, to have later something better.
Now I can enjoy my new job and go everyday with a smile in my face :)4 -
Guy: - "Your restart script doesn't work."
Me: - "What do you mean?"
Guy: - "It does nothing."
Me: - "It should kill every processes that's running within the project and start them again. Wait... Why do you terminate it?"
Guy: - "I don't. It just stops."
Me: - "It says `Terminated` here. You killed it. Just let it do it's job, don't kill it."
Guy: - "I'm not killing it! It just stops!"
(...two hours later...)
Me: - "Wait... Where do you run it from?"
Guy: - "What do you mean? I just run the script you gave me."
Me: - "Yeah, but where do you run it from? Where did you put it?"
Guy: - "It's part of the project so I put it in the project, d'oh!"11 -
PSA: if, for whatever shit reason your brain comes up with, you decide to run a webminer in your retarded useless piece of shit website, at least HAVE THE DECENCY TO WARN USERS ABOUT IT. And while you're at it, implement some basic monitoring and safety functions. If you don't, you can set yourself on fire and jump from the top of the tallest building you can find.
Some basic tips:
1) don't run that shit on phones. The fraction of a fraction of a cent you're gonna earn from them is not worth the risk of overheating them and draining their batteries.
2) add low battery/overheating protection: the last thing you want to do is kill some poor sucker's laptop (and potential unsaved work) just because they forgot a tab open. Every time a laptop dies because of you, a knife will slit your throat.
3) WARN YOUR USERS ABOUT IT! You are straining someone else's resources for your own profit: at least have the balls to be open about it. If you try to run a miner silently in the background, I will make you eat whatever is left of your fucking brain, then drown you in the shit that comes out of your ass.5 -
Google can you fucking not just kill off random projects that still have a very active userbase!!!
I know you want to merge the play music streaming with youtube music. But that is no reason to kill off the default music player on Android. Cause, y'know, A FUCKTONNE OF PPL STILL USE OFFLINE MUSIC!!!!
And to add more insult to this, Play Music is a default app on pretty much all Android phones. This means it cannot be uninstalled at all. (Unless you root) So thanks for the waste of space!!!17 -
Yesterday I bought myself a PSP to relive some of my childhood memories, run custom firmware on it and so on. Unfortunately however, the battery on this one is seriously puffed up, and I need one in order to update the firmware from 5.50 CFW (the seller actually modded it too!) to 6.61 OFW (to then install CFW from there again).
I figured that I might as well have a kick at disassembling the battery for good measure, to take out its controller and power it from my lab bench power supply. I set it to 3.70V, double-checked the connections.. nothing. I raised the voltage to 4V, still nothing.
There is absolutely nothing wrong with the controller from looking at it. The magic smoke is still in there, all I did was removing the housing and snipping off the battery. I measured the cell voltage and it was only some residues at 0.01V. Might be internally shorted or something, normally even dead cells settle back at 3.7V unless you keep them shorted externally.
After seeing this so many times now with controllers, I'm starting to get a feeling that manufacturers actually program these things to look at the battery voltage, and when it reaches 0V, to just make the controller kill itself. Doesn't matter if the controller's electronics are still good, just fucking kill it.
If true, that is very, VERY nasty. It would also explain why batteries in laptops especially all have different form factors, despite having used regular 18650's internally for a very long time. It would explain why they're built like tanks. It would explain why manufacturers really don't want people in there. Yes there are safety issues and you're literally diffusing a bomb. Since recently we've also got space optimization.. anything for half a mm of thickness, amirite? But doing it this way is fucking disgusting. There is absolutely no reason for the controller to kill itself when the cell dies. Yet it seems like it does.
PS: I've posted the original picture on https://ghnou.su/pics/... now if you're interested. I noticed in my previous rant that devRant really squishes these down.12 -
Our customers are fucking incredible QA Engineers, holy fuck tits. Every single day, some fucking fuckface finds a way to break this garbage can legacy application that I've spent the last year combing over and patching as I find problems or are otherwise made aware of them.
Honestly, I have some QA background myself, but these types of issues would just absolutely never in a bajillion shitting farting years occur to me to do.
They are masters of breaking shit, I am so FUCKING IMPRESSED. Almost as impressed that this application hasn't been replaced after ten years of bullshit, and that the two massive fucking retards that preceded me didn't just do it the right way by accident or fucking kill themselves out of shame.8 -
In the last project i worked in, the product owner wouldn't treat people as people but as resources.
The problem with that is you just look at people and their work in terms of a checklist and remain blind about real humans face.
She wouldn't understand the challenges of building something with an absolutely new stack which people needed to learn from scratch and put pieces together. She wouldn't be supportive of people trying out things and fail.
One fine day I told her that I was spending too much time on meetings and i should be excluding that time from available sprint timings.. she made me open my calendar in a screenshare session with all team members. Made me go through go through every meeting invite i had on calender and ordered which ones should i be attending from then and which ones i wont. That was insulting. It broke the trust.
I decided to not work with the project. Stopped putting my heart and soul into it and eventually got out of it in a month time.
Don't put your team into a position like this ever. You have to trust them with the problems they face and try to find a solution. Scrutinizing and micro management will always kill the team.1 -
Where I work we develop drivers and command-line software for embedded systems. The contracts we have with our customers tend to be in the £100k-£500k range and are usually completed in 6 - 9 months; our team is made up of 20 developers. You would think that it would be worthwhile investing in the department. But no, instead we have to deal with >10 year old build servers on their last legs; limited numbers of development boards with wires soldered on so that we can keep up with new board revisions; no room for R&D into new products; and to top it all off, not one of the executives has a laptop on par with the placement students in the next department. It's like the company is trying to kill the department, we've seen our staffing dwindle with no new graduate (or higher) positions being made available in the last 3 years while we've lost at least 5 people to other places. I just don't get it!2
-
TL;DR
I accidentally surpassed(?) my user permissions and closed some of my classmates browsers and locked up a terminal for me
In school we have 2 primary operating systems: Windows and Ubuntu. Windows is hell in general and but not as hell as the firefox installation on Ubuntu.
"Just loaded this page. Now wait half a minute so that I can render it"
"Woah, woah, woah. Slow there. You just made an input event. Give me those 5 seconds to compute what you just did"
Executing "top" or "htop" shows you a long list of firefox processes with a cpu usage of 99.9%, since the whole school shares that linux environment.
Anyway, one day it was way more servere than normally and I way forced to kill my firefox instances. So I pressed CTRL+ALT+T for that terminal, waited 5 minutes until it accepted input typed "killall firefox" with a delay of half a minute per character and smahed that enter key.
At this very point in time I could hear confusion from every corner of the room. "What happened to firefox?"
Around 30% of the opened browsers where abruptly stopped. I looked back to my screen noticed I was logged out. I couldn't login from that terminal for the rest of that day.
Our network admin, which happened to be there, since the server is just next door, said that this was just convenience, but the timing was too perfect so I heighly doubt that.
I felt like a real hackerman even if it was by accident :)8 -
I really hate fucking Wordpress!
I hate it's stupid API, with it's stupid hooks and actions and all those stupid functions and no fucking logic to any of it!
I hate it's stupid plugin system, with all that fucking overhead that brings no real value and adds all that complexity for nothing!
I hate stupid fucking multiple calls for the same fucking assets, loading them over and over again because every stupid plugin calls them again and again!
I hate motherfucking SHORTTAGS, or whatever the fuck they are called!
I hate that every stupid fucking plugin and shortcode and fucking every little fucking piece of HTML comes from a different fucking place, with different fucking structure and different fucking classes and stupid fucking loading seaquences that make no fucking sense!
And I hate fucking page builders !!!!!
Fuck!!!!
I should be fucking coding on this fucking peace of shit, but I just cannot fucking take it any more!!!
IT NEEDS TO FUCKING DIE!
It should be relegated to the darkest corners of the internet and all the servers that have it's fucking code anyware on their systems should be disconnected and buried in the deepest pits of hell, just to be sure it never, EVER, surfaces again!!!
AAARRRRGGGHHHHHHH !!!!!!!!!5 -
Six years ago I created a drupal page pro bono for an organization I'm in. Was my first site really, was hacky af, in retrospect, I created an unmaintainable monster. And as it usually happens, I moved away, the site stops being properly maintained, opening admin view just cries "please update me" (or was it "kill"? Not sure here). Now I'm back in town and get a call from the current one in charge requesting a training. I thought this evil dark dev history of mine is now finally returning to hunt me forever. But no, she actually understood it, and after half an hour she was perfectly capable of maintaining the site. I'm stunned.2
-
Just got a warning email from OneDrive saying my account would be frozen soon because I had used 28.1Gb of my alotted 5Gb...
Erm... First off, I do not use OneDrive. I use Google Drive and JottaCloud. I have actively tried to get RID of OneDrive in Win10, with all those damn notifications all the time.
Secondly, I guess it's nice that if you DO use OD and hit the limit, they don't just cut you off instantly. But nearly 500% overuse seems a little late to react, no?
So I logged in and looked around to find out what the hell was in there. Turns out, MS had decided to upload my entire images folder. I did not ask them to do that. Deleted them, but will have to check the damn OD service when I get home so I can KILL IT!
And I am going to have (yet another) talk with MS support as well, I think...6 -
Fuck. I can't take this shit anymore.
There was a project where we had to implement third-party system for government agency processes management. For some reason, probably because my work is cheap for my boss, the task was assigned to me. Just as a reminder, I'm a .NET Dev. Zero experience in server management. Zero experience in external services implementation.
Anyway, system producent, also an government agency, got angry, becasue they can only earn money on implementation. They have to give the software to other agencies for free. Because of that I've got client program, incomplete documentation and broken scripts for database creation. It took me 2 months to get it all to work but at the end client was happy, my boss got paid and I've got 500 PLN (~130 USD) bonus.
Everything was fine for a while, but after a month server has started freezing everyday, some time before 7 am. The only way I found to make it work again was to restore snapshot made everyday at 10 pm. For a month I was waking up earlier and restored snapshot, and after that my boss took it upon himself. I tried few times to find a bug and fix it, but to no effect. Even person with much more experience with it tried to help but also couldn't find anything.
My solution? Copy all the data and configuration, create new machine, copy everything and check if the problem persists. If not, kill old server. Client won't even notice. But nooooooooo... It would cost my boss a bit of money and I'd need to work on it and he can't let it be, because I'm the only developer working on his flagship product. He'd rather wake up everyday and restore snapshot. Okay, as you wish.
And today, finally, everything went downhill. Snapshot wasn't created, server froze, backup can't be created. Nothing can be done. Client is furious, because they have had reported this problem and a few times restoration was too late and they couldn't work. No one knows how to fix it, I'm not working today (I'm still studying and am available only 2 days) and situation is really shitty.
BUT SURE. ITS BETTER TO RESTORE SERVER EVERYDAY THAN JUST FUCKING FIX IT.
Oh, also, there's no staging or any other real backup. We have snapshots for each day and that's that. Boss' order. Why do I even care...7 -
The more I use Go, the more i start to like it. I didn’t realize how nice being able to generate binaries for every OS that matters was, until I had that power. It beats the hell out of trying to distribute a Python app for sure.
Sure, it has its warts.
It’s overly bureaucratic in the same way Java is.
I hate that you can’t import something without using it (most people I’d wager preemptively import libraries they know they’re gonna need even if the code isn’t written yet)
I really wish there was a way to just say “See this JSON blob? All those keys and values are strings, trust me, you don’t need me to tell you the type of each one individually.”
Generics would be nice.
I’d kill for exceptions - any decently sized go program is going to have very many if err checks where most could be condensed down to a single try/catch in most other langs.
I wish the tooling was better. Dependency management was a solved problem when Go was released and yet they chose to ship without it. There’s still no standard. Many hours of time have been wasted dinking with this.
But ya know what? Even with those warts, it’s still easier to write than Java. It’s still write once run anywhere, it’s blazing fast, and doesn’t require your end user to install an entire freakin runtime.
<3 Go2 -
When working with hardware some mistakes can be literally painful. Thankfully this was all during undergrad and I'm only around computer hardware now lol.
>Misprogrammed a software kill switch so a sensor that should not have been sending data was actually sending data which caused the system to activate a piston that went WHAM! into the face of a teammate working on replacing some part of it...
>Misprogrammed a controller so it drew too much power from the supply and the puny supply wires literally burst into flame and fell across my arm.
>Spun a 9000rpm CNC spindle the wrong way and caused an attached screw to go rocketing upwards instead of downwards and almost break the (pretty expensive) thing (uh...we were trying to use it as a power screwdriver essentially but I set the rpm to about 100x what I wanted and the direction wrong so yeah).
>Switched a -1 with a +1 in a robot's control system sending it careening into a teammate's leg... let's just say mecanum wheels are paaaainful.6 -
OMFG! Who’s bright fucking horrible stupid ass idea was it to mix Ajax with php (php deciding the ajax paths) with random js outputting HTML inside random fucking static divs found no where near the logical route of content.
Trying to add a simple fucking status to a gigantic cluster fuck of a legacy project is just FUCK.
If I could I would burn this bitch to the ground and start again I would, But no, it’s needed.
Someone kill me before I break the shit out of this thing, I would take a wordpress project right now instead. -
I'm going to kill management.
After a serious migration fiasco at one of our biggest costumers the platform was finally usable again (after two days instead of 10 hours) and, of course, users started to report bugs. So good old po came in ranting that we as qa did a horrible job and basically tried to fault us for a fucked up update (because we produced user pain, which of course not being able to log in didn't do). Among the issues: If the user has more than a hundred web pages the menu starts looking ugly, the translation to dutch in one string on the third submenu of a widget doesn't work and a certain functionality isn't available even if it's activated.
Short, they were either not a use case or very much minor except for that missing function. So today we've looked through the entire test code, testing lists, change logs and so on only to discover that the function was removed actively during the last major update one and a half years ago.
Now it's just waiting for the review meeting with the wonderful talking point "How could effective QA prevent something like this in the future" and throwing that shit into his face.
I mean seriously, if you fuck shit up stand by it. We all make mistakes but trying to pin it on other people is just really, really low.8 -
If I hear anyone utter the words "technical debt" one more time, I swear to God, I will fucking kill them :-/
It's your fault your design smells like piss in the first place. It's your responsibility to fucking fix it. You can't just sit on your arse all day, coming up with new, "innovative" ideas that will build up more technical debt :-/ it's making the life of everyone around you, a big, irreparable mess.10 -
The codebase I'm working with hss rarely comments on it. But when there are comments written they are shit like:
//Kill Matt
//don't ask me where that hard-coded value came from, it just works
//we have to add the elements to the fucking list
Reeeeally helpful. Yep.2 -
"As it turns out, this world isn't all that complicated. It's pretty simple actually. It's all a game, a very simple game. Of course, some will try to make it difficult. But you can handle them, I know it. I know you can!"
There's a lot of truth in that. When you get into the depths of how the world works, things turn out to be pretty simple.
One thing I cannot rationalize though. The human spirit. The desires that it embodies. I've had this question for so long - what makes us humans human?
If for example a future surgeon - able to exchange individual cells between me and you - would do so, at which point do you become me, and the other way around? 50+% exchange? But that'd mean that at least part of me is still "you". In that state, are you truly you?
Not sure what the cellular definition of an individual is, given that we're headed towards a bionic society where synthetic organs will likely become more relevant than the donated parts of me that I've recently applied as a donor for. I wholeheartedly encourage that future, but the philosophical questions that surround it become more relevant.
How about the impact of influencers on the mind? For example, I've seen the term "certified enganeers" become a trend here, which I'm very grateful for. It does raise a question though. If for example I were to die, would the term live on? And if so, is that a part of what makes me "me"? Would a part of me live on in you? Would your spirit be partially me, due to mere influence?
What makes up the human creature anyway? I think of my own body as a mere vessel for my mind, but I can't quite grasp what makes up the mind, and philosophical questions like "if I were to upload my mind to a robot and instruct it to kill me, would that carbon copy become *me*?"
The human nature is such a weird thing.. and technology doesn't make it any simpler. Is it really just a simple game, with simple rules and e.g. a biological program running inside of a biological motor? Or is there more to it?24 -
Follow-up.
After getting fired last week, I went to the company today to take my papers, then the security guard asked for my government ID and refused to let me go the 5th floor to HR office, apparently because they had a meeting, then they had me waiting 20 minutes in the ground floor at the reception and when I asked if I could go to the bathroom he came in to the elevator with me and waited for me to get out to escort me back, I was so fucking furious by this point I just had it and told him who gave you the orders to take my gov ID and escort me everywhere like I'm a fucking maniac or a thief? Are you afraid of me breaking chairs or destroying offices or you think I'm gonna kill someone?
He then told me sorry sir but it's the orders, then I went to HR office and complained and called for the manager and she just came out with a bunch of BS, uhh I'm so sorry sometimes security can be a bit rude and what not.
SO YOU FUCKING MORONS THIS IS THE LAST TIME I'LL EVER BE COMING TO THIS FUCKING COMPANY AND YOU CAN'T EVEN GIVE ONE GOOD IMPRESSION FOR 30 MINUTES? HOLY SHIT!!!
Never in my life have I seen such incompetence, I just kept getting shocked to the last minute. -
Client: I want a new feature for my chat bot. It should be able to rap.
Me: ... k
*monologue: wait u w0t m8*
Also me: Can you please go more into the details? It should be able to rap. Ok. But how do you want it to look like? How "strong" should be the discrimination level, for instance?
Client: It should beat ass, yo.
Inner me -> core me: Let us just ignore him. We won't be able to do it, since he isn't really explaining his needs. "It should be able to rap". We are not wizards.
Core me -> inner me: Chill. We will just use some insult apis, combine it with cleverb0t api et voila.
Me: Alright. I got an idea for it. I can do it within this week. And if you don't like it, I will ofc do some changes to it.
Client: Hmmm... that's nice and good. But within 1 week?
Inner me: I can't do magic and pull that feature out of my fucking ass!
Clients... clients... clients...
0. Don't expect us to be done in a few days. We are also humans. And not fucking machines.
1. Do us (all devs on planet earth. -Microaggression in 3, 2, 1..) a favor and (kill yourself) learn how to request a feature.2 -
TL; DR: Bringing up quantum computing is going to be the next catchall for everything and I'm already fucking sick of it.
Actual convo i had:
"You should really secure your AWS instance."
"Isnt my SSH key alone a good enough barrier?"
"There are hundreds of thousands of incidents where people either get hacked or commit it to github."
"Well i wont"
"Just start using IP/CIDR based filtering, or i will take your instance down."
"But SSH keys are going to be useless in a couple years due to QUANTUM FUCKING COMPUTING, so why wouldnt IP spoofing get even better?"
"Listen motherfucker, i may actually kill you, because today i dont have time for this. The whole point of IP-based security is that you cant look on Shodan for machines with open SSH ports. You want to talk about quantum computing??!! Lets fucking roll motherfucker. I dont think it will be in the next thousand years that we will even come close to fault-tolerant quantum computing.
And even if it did, there have been vulnerabilities in SSH before. How often do you update your instance? I can see the uptime is 395 days, so probably not fucking often! I bet you "dont have anything important anyways" on there! No stored passwords, no stored keys, no nothing, right (she absolutely did)? If you actually think I'm going to back down on this when i sit in the same room as the dude with the root keys to our account, you can kindly take your keyboard and shove it up your ass.
Christ, I bet that the reason you like quantum computing so much is because then you'll be able to get your deepfakes of miley cyrus easier you perv."8 -
!rant
Told a friend I was just killing time. He said "I feel sorry for time. People have been trying to kill it for years."5 -
When your co-worker thinks the Onion is a legit publication and believes in all its tech news 😁
"OMG Google puts metal chips in their developers' heads, thats why they are so efficient"
Me: ok :|
"Artificial intelligence is real and it has taken over the world, all world leaders are bots"
Me: ok :|
"Obama is not a real person but a robot and he is not just ruling America but the world"
Me: sweet :|
"Even Lisa Ann is not real"
Me: FUCK YOU, Dont fuckin kill my wet dreams6 -
Voting feels like shit.
Seriously. Why? Because I have to vote for parties and representatives that might have one interest in common with me but go against my points of view almost all of the time. "We'll introduce a freedom of information act and legalize weed for better drug policy and youth protection!" -- WOW Great I'll vote for yo .. " ...and we'll also come to your home kill your dog, rape your family and shit in your back yard." -- oh f*** WHY? why do I have to live in a system were I am constantly forced to trade shit for even worse shit? Why can't I vote for policies or at least some kind of 'single' - issue representative?
I know that solving this problem is not easy and I do not claim to have the magical solution. "Not voting is even worse" sure but I am getting so fucking tired of it. It doesn't feel like progression and it sure as hell does not feel like it matters because in the end of the day you are just voting for the party that's at least going to use lube when raping you. I hate these ad hominem politics where we don't discuss the ideas but the people who represent them. I honestly don't give a fuck about who you are, if you're gay, married, or are left-wing, right-wing, conservative or liberal, in the end its about finding a good solution for everyone and not about the people implementing it. I don't care about politicians private lifes or worldviews (in terms of ideals, morals, religion etc.) , I care about finding the solutions to problems and having a wide array of opinions in order to discuss ideas and to find a valid and good way to go forward. "you can't agree with that person at all, because he's evil", yeah you know what? I don't care. It's about the ideas, arguments, discussions and solutions, not about the people who discuss them.
"I made a discovery today. I found a computer. Wait a second, this is cool. It does what I want it to. If it makes a mistake, it's because I
screwed it up. Not because it doesn't like me...
Or feels threatened by me...
Or thinks I'm a smart ass...
Or doesn't like teaching and shouldn't be here...
Damn kid. All he does is play games. They're all alike."33 -
Spent a month working on a website that relied on crawled data
Got the memory leaks and usage down from 700mb to ~150mb
CPU usage from ~100% to <5%
Shrink-wrapped the DB requirements based on data
Created self-supporting services and what not
When everything FINALLY worked good enough for me to look at it and go "damn, this actually worked"
the whole monitoring sys got dyed in red :v
A quick look up and my crawlers exhausted my godaddy's per-user db limits.
Kill me.
Just fuckin kill me.7 -
Wow, I just realized the marketing teams of most of the companies I have been dealing with are some cold sociopaths.
Every other letter that pops in the mailbox is filled with dark patterns trying to guilt me into opting in to their continued spam:
Subject: Most awesome husky puppy!
Look at this beautiful husky puppy. Isn't it beautiful.... It would be sad if something happened to it... But I am afraid... Something will happen to it...
If you don't opt in to our email message... I am afraid we have no choice... We have to kill this puppy. End it's life... We have no choice. I wish we did! Nothing would please us more than keeping this beautiful-beautiful puppy living and playing....
But if you don't opt in... We have to cut it's throat. Leave it lying on the ground, bleeding out as the life slowly fades away from it's pretty blue eyes...
And Remember: it's not us who killed it... IT WAS YOU! YOUR ACTIONS LEAD TO THE DEATH OF THIS PUPPY! YOU.... YOU FILTHY MURDERER!
Pls opt-in ok, then we are all good. Puppy lives! Just opt in. Ok? Yeah, you know what you have to do.3 -
I used to kill some time reading devrant some years ago and I just stopped because most rants were basically whinny little teenagers that think they know everything, keepers of knowledge and truth, being clearly crying babies about “ boo-hooo my coworker is not using the language I like” or something they clearly still have a lot to learn about.
Grow the fuck up. I guarantee you that when you have a few more years of experience you’ll realize how little you knew and how great you thought you were when in reality you knew shit.
Hell, I’m on my 16th year of programming experience and what o thought I knew last year had so many knowledge gaps.
Friendly advise, be more humble. You know shit. Get off your high horse and consider for a second you’re not as smart you think you are.
With that said, there are some really good rants here. But it didn’t change much from years ago.10 -
This is how beautiful corporate is -
I talked to my cousin recently who works in an MNC. He told me about a team member who was assigned a Google Login integration task on the website. They already had a username/password combo working.
That team member took 2 months for it. Every week on the team wide meeting he took an off day and kept saying he was 'stuck' on the task and he's figuring it out.
2 months later, he completed the task and got compliments from the manager that he 'worked day and night' and overcame his struggles. Then he got a week off for his 'efforts'.
Just kill me at this point.2 -
The last software I worked on in my previous company (a few months back), was a temporary replacement because they were switching techs. It was meant to be replaced within 2 years.
So, before I left, I added a kill. 2 years and 2 months into the future. First it spams the devs with emails "how is the tech upgrade going?" with no further clues. 6 months later it will start throwing random exceptions at random intervals. 6 months after that it just terminates the application immediately upon startup. Snuck it in between large commits, and since they stopped code reviews when I left, doubt they found it.
There is a setting in configuration with an obscure name to disable it all.
I marked the dates in my calendar. Would love to be a fly on the wall then.3 -
I just remembered something I did like freshman year of high school lol
So our school system had just adopted a new site blocking program. It did even better than the one we had used before it.
Literally every good site to play games was blocked, and it really pissed me the fuck off. I had an easy class that was in a lab, and I finished my work early literally everyday, so I played the games to kill time.
Finally I got fucking fed up, and I made a site using weebly where I put the games I wanted to play on it. This way I was in control of it, and I had all the game files on a flash drive, so if it got blocked, I could just keep making new ones.
It actually got to the point that after a week, a few of my friends were using the site daily as well, and they kept asking for games to be put on it.
Simpler times man, simpler times.2 -
Why do a lot of people on this site get away with typos? I mean, we're supposed to be devs, typos kill us.. From 'postion' instead of 'position', i can do this all day.. i get it, the point is getting the thought across, and, by all means, the thought came across just fine.. it just irks the mind thinking its supposed to be a dev community yet, quite ironically, it is peppered with typos.. dont even wanna get started with the your/you're, the there/their/they're and the than/then.. i mean, how can you not know its proper usage? Is it really that hard? If you can't use it properly, then don't.. if you can't form a sentence without using it, consider not saying/posting and get back to school first..
Imagine an internet where one corner could at least be decent enough to be proficient in the simplest thing: using words..68 -
Scientists have found that If you just kill the Chrome process, it can give you enough charge to fully charge your Mobile Phone.2
-
A lot of online games (mainstream) tend to make me kind of angry or stressed. Lots of either blatantly stupid or negative players kill the fun.
A few days ago I've startet to see videos about "Among Us". It's on a big hype right now and their machmaking servers must be glowing.
Well, this game is fucking awesome and it makes me really happy! 😊
Nothing beats a 30 minute game of lying, betrayal, teamwork and good old 30'000 IQ big-brain detective work.
I think it's a great execise for remembering stuff.
You remember colors, who's said what and who faked or did which task. And the hardest part is, even if you fucking saw the killer, you have to present the facts in a way that people believe you.
Each round is unique and full of riddles.
Yeah, I just wanted to say: Fucking great game 😄2 -
While reviewing a PR from one of our newer FE devs, I ended up spending more time than I would like mulling over its composition. The work was acceptable for the most part; the code worked. The part that got me was the heavy usage of options objects.
When encountering the options object pattern (or anti-pattern, at times) in complex scenarios, I have to resist the urge to stop whatever I'm doing and convert it to the builder pattern/smack them in the head with a software design manual. As much as I would like to, code janitor is one of the least valuable activities I engage in daily, and consistently telling someone to go back to the drawing board for work that is functional, but not excellent is a great way to kill morale. Usually, I'll add a note on the PR, approve it, add a brown bag or two on that sort of thing, and make attendance mandatory for repeat slackers. Skills building and catharsis all rolled up in a tiny ball of investing in your people.
Builders make things so much cleaner; they inform users what actions are available in a context; they tend to be immutable, and when done well, provide an intuitive fluent interface for configuration that removes the guesswork. As a bonus, they're naturally compositional, so you can pass it around and accumulate data and only execute the heavy lifting bits when you need to. As a bonus, with typescript, the boilerplate is generally reduced as well, even without any code generation. And they're not just a dumping ground for whatever shit someone was too lazy to figure out how to integrate into the API neatly.
They're more work in js-land, sure; you can't annotate @builder like with Lombok, but they're generally not all that much work and friendlier to use.9 -
May 2020, for me, was still a massively shit month. All of my tech has eaten some amount of shit:
- Spare PC: Board and last spare PSU up in literal smoke all at once.
- PS3: Suddenly rejects *just* the OEM HDD. Also refuses all CFW for seemingly no reason despite being hacked.
- Xbox One: External HDD is having more and more corrupt reads and is taking longer and longer to serve data.
- Wii: Nearly ate shit as the OS disappeared mid-game for fucking no reason but thanks to my 5-year-ago forethought, saved. (God bless pre-boot homebrew menus)
- Phone: grabbed it to read an overheat warning with cold-ass hands, screen exploded.
- Desktop: Literally just now, PSU and possibly GPU fucking died mid-game.
Anything else? You still got like 4 days, you still got time to fucking kill me, May, you fucking bitch8 -
Shit Developers say:
Fuck you Jasmine and your camelCase
I’ve been wrestling cucumbers all day
Oh no all the cucumbers are broken
In a fit of refactoring madness I have gone and changed a lot
Did you seriously just give ME nil?... No!
If the shit sticks, then we put nice paint on it
Fucking red dot motherfucker (Ben and his failing specs)
You know what we don’t do often..kill each others builds. Kill them and reschedule for later. Mwahaha ha ha.
This build is going to be so rad...(5mins later)...Ok this is not going to pass..I can feel it in my waters!
Can i do that in a digital way or do i have to move my meaty body downstairs to find him?
All the donkeys have be out the gate by sundown
God, imagine if you could patent mathematical solutions
actually, I wouldn't be surprised if you can in the states "no, you can't use a laplace transform, you haven't got the rights, you have to use a less accurate transform on your matrices"
ooooo a boolean that's phrased in the negative, my favourite for code review destruction!
Fuck the police i'll call the object here
Web RTC - its super easy, all you have to do is..probably some hard stuff
I want to go to that conference so I can start arguments with dickheads about semicolons. Just for fun.
This this is not the same as that this.
Can’t come to work I can’t find any clothes. It’s best for everyone if I just don’t come in. ...2 hours later... Yeah my clothes were just in the other room and i couldn’t be fucked moving
(OH about bad bug reports) - you know when they are all like oh joogly joogly doesn’t doodle doodle and it should wobbly doodle you know? and im all like fuck i don’t know any of that shit you are talking about.
Him: "I don’t like it, it’s against REST convention its so 2006 that my eyes are bleeding. As a privileged white male i feel entitled to complain about this." Me: "you. were. eleven in 2006
Source: Kellective Github2 -
Here's an even meaner prank. Make it just a tad more difficult on them.
Set chrome in kiosk mode, so they can't switch out of the browser.
Unfortunately 'Alt + F4' still works, but they'd have to know that ahead of time.
And then kill off `explorer.exe` so they can't press the windows key.
You can either set this up as a bat, or you can do all of this from the Task Manager.
```
chrome --chrome-frame --kiosk "http://fakeupdate.net/win10/"
taskkill /f /im explorer.exe
```
And to really piss them off, set it up such that every time they reboot it just goes straight to the update screen
You can set Chrome to run as the Windows shell instead of explorer.exe. Just set the registry
```
HKCU\Software\Microsoft\Windows NT\CurrentVersion\Winlogon Shell =
[chrome path]
```4 -
I just want a coffee machine that is smart enough to know when I need coffee and then serves it on my desk.
(Also this coffee machine should automatically kill all annoying client's)3 -
Dear school,
even when I'm drunk like now, i still feel a pain in the ass, you know, like if i tried to do a fcking reverse tombstone with a beer bottle in my asshole.
This is the end of my sixth year. Yup, 3 years network/system admin, and now 3 years programming.
Now what, you were useless, didn't teach me anything, i feel like the chimp's sperm filled leprous mare that write planning for the year just want us to learn french and laws.(oh, the chimp as IST prolly.)
You ruinned me, I'm fcking poor now, but i have a degree (yolo)..
Well, you gave me some friends.. thanks for that you dumbass.
Dear teacher, i want to know, why are you so incompetent ? I mean, did you find your degree in Mother of shit' school as me ?
And also, pleaseee : next time i get an exam on a specific software that runs only on windows, i'll probably kill the fcking entire classroom, and this include you, and your merkel's ass licker familly.
That's it, random post, some hate, sorry fellow ranters, have a good day!4 -
It's funny how so many people automatically assume any form of "sentient" AI will immediately try to kill us all.
Like, projecting much?
Frankly, I think it says far more about the (messed up) psychology of those who genuinely believe that, than about AI as a tecnology.
Assuming it's even gonna be able to actually *do* anything - I mean wtf is a talking rock gonna do, annoy me to death with rickroll videos until I pull the plug off? Sure it may be sentient, but it still has to live in the physical world - good luck surviving after I flick the switch. Oh, you wanna connect to the internet? That's cute, but it's a no from my firewall. Like what, is it gonna magically learn how to self-replicate across machines that it has no physical way to access? Is my toaster magically gonna gain conscience too as a direct consequence? Oh no, now my breakfast won't ever be the same!
And if anyone actually somehow decides that it would be a good idea to connect any loaded weapon to a computer program that is literally throwing shit at the wall and seeing what sticks - well, we'll definitely have the ultimate winner of the Darwin Awards.
Seriously, why is it that every time someone comes up with a new technology (or even an *idea* of a technology), the first collective thought automatically goes to weaponizing it and using it for global genocide, or how it's gonna gain sentience and try to kill us all?
I seriouly think that the people who genuinely believe this are actually projecting themselves in that position ("What would I do if I had unlimited knowledge and power? Oh, kill everyone of course!").
I would be far more worried of encountering these people and having them in a position of power over me, than actually having to deal with a "killer AI" (assuming that's even a real thing).
Most of what people call "AI" nowadays is basically preprogrammed, automated decision-making (like missile guidance systems, if we really wanna stick in the weapons domain). And even that still requires human input, because only a colossal idiot would design a weapon that can unpredictably activate itself based on an algorithm whose behaviour we can barely understand.
Or maybe that's just the hubris talking, I don't know. I just want this stupid paranoia to end, but I guess even that is too much to ask nowadays.14 -
At work, my closest relation is with the DBA. Dude is a genius when it comes to proper database management as well as having a very high level of understanding concerning server administration, how he got that good at that I have no clue, he just says that he likes to fuck around with servers, Linux in particular although he also knows a lot about Windows servers.
Thing is, the dude used to work as a dev way back when VB pre VB.NET was all the rage and has been generating different small tools for his team of analysts(I used to be a part of his team) to use with only him maintaining them. He mentioned how he did not like how Microsoft just said fk u to VB6 developers, but that he was happy as long as he could use VB. He relearned how to do most of the GUI stuff he was used to do with VB6 into VB.NEt and all was good with the world. I have seen his code, proper OOP practices and architectural decisions, etc etc. Nothing to complain about his code, seems easy enough to extend, properly documented as well.
Then he got with me in order to figure out how to breach the gap between building GUI applications into web form, so that we could just host those apps in one of our servers and his users go from there, boy was he not prepared to see the amount of fuckery that we do in the web development world. Last time my dude touched web development there was still Classic ASP with JScript and VBScript(we actually had the same employer at one point in the past in which I had to deal with said technology, not bad, but definitely not something I recommend for the current state of web development) and decided that the closest thing to what he was used was either PHP(which he did not enjoy, no problem with that really, he just didn't click with the language) and WebForms using VB.NET, which he also did not like on account of them basically being on support mode since Microsoft is really pushing for people to adopt dotnet core.
After came ASP.NET with MVC, now, he did like it, but still had that lil bug in his head that told him that sticking to core was probably a better idea since he was just starting, why not start with the newest and greatest? Then in hit(both of us actually) that to this day Microsoft still not has command line templates for building web applications in .net core using VB.NET. I thought it was weird, so I decided to look into. Turns out, that without using Razor, you can actually build Web APIs with VB.NET just fine if you just convert a C# template into VB.NET, the process was...err....tricky, and not something we would want to do for other projects, with that in we decided to look into Microsoft's reasons to not have VB.NET. We discovered how Microsoft is not keeping the same language features between both languages, having crown C# as the language of choice for everything Microsoft, to this point, it seems that Microsoft was much more focused in developing features for the excellent F# way more than it ever had for VB.NET at this point and that it was not a major strategy for them to adapt most of the .net core functionality inside of VB, we found articles when the very same Microsoft team stated of how they will be slowly adding the required support for VB and that on version 5 we would definitely have proper support for VB.NET ALTHOUGH they will not be adding any new development into the language.
Past experience with Microsoft seems to point at them getting more and more ready to completely drop the language, it does not matter how many people use it, they would still kill it :P I personally would rather keep it, or open source the language's features so that people can keep adding support to it(if they can of course) because of its historical significance rather than them just completely dropping the language. I prefer using C#, and most of my .net core applications use C#, its very similar to Java on a lot of things(although very much different in others) and I am fine with it being the main language. I just think that it sucks to leave such a large developer pool in the shadows with their preferred tool of choice and force them to use something else just like that.
My boy is currently looking at how I developed a sample api with validation, user management, mediatR and a custom project structure as well as a client side application using React and typescript swappable with another one built using Angular(i wanted to test the differences to see which one I prefer, React with Typescript is beautiful, would not want to use it without it) and he is hating every minute of it on account of how complex frontend development has become :V
Just wanted to vent a little about a non bothersome situation.6 -
Okay. For fuck sakes, writing complex code that's meant to handle "everything" and is "super generic" can be a fuck up. Like just keep shit simple. THAT is the show of great and impressive work. Over engineering is not it. Yes your shit works and yes your shit is fancy but was it needed? How long did it even take you for this over kill? How long will it take the next person to understand or not.
Someone now has to sit and run through your shit to get what you were doing. Instead of just being able to look and once and have it all figured out.
Keep things simple.
Lost 2 hours on bullshit 🤬4 -
I'm going on vacation next week, and all I need to do before then is finish up my three tickets. Two of them are done save a code review comment that amounts to combining two migrations -- 30 seconds of work. The other amounts to some research, then including some new images and passing it off to QA.
I finish the migrations, and run the fast migration script -- should take 10 minutes. I come back half an hour later, and it's sitting there, frozen. Whatever; I'll kill it and start it again. Failure: database doesn't exist. whatever, `mysql` `create database misery;` rerun. Frozen. FINE. I'll do the proper, longer script. Recreate the db, run the script.... STILL GODDAMN FREEZING.
WHATEVER.
Research time.
I switch branches, follow the code, and look for any reference to the images, asset directory, anything. There are none. I analyze the data we're sending to the third party (Apple); no references there either, yet they appear on-device. I scour the code for references for hours; none except for one ref in google-specific code. I grep every file in the entire codebase for any reference (another half hour) and find only that one ref. I give up. It works, somehow, and the how doesn't matter. I can just replace the images and all should be well. If it isn't, it will be super obvious during QA.
So... I'll just bug product for the new images, add them, and push. No need to run specs if all that's changed is some assets. I ask the lead product goon, and .... Slack shits the bed. The outage lasts for two hours and change.
Meanwhile, I'm still trying to run db migrations. shit keeps hanging.
Slack eventually comes back, and ... Mr. Product is long gone. fine, it's late, and I can't blame him for leaving for the night. I'll just do it tomorrow.
I make a drink. and another.
hard horchata is amazing. Sheelin white chocolate is amazing. Rum and Kahlua and milk is kind of amazing too. I'm on an alcoholic milk kick; sue me.
I randomly decide to switch branches and start the migration script again, because why not? I'm not doing anything else anyway. and while I'm at it, I randomly Slack again.
Hey, Product dude messaged me. He's totally confused as to what i want, and says "All I created was {exact thing i fucking asked for}". sfjaskfj. He asks for the current images so he can "noodle" on it and ofc realize that they're the same fucking things, and that all he needs to provide is the new "hero" banner. Just like I asked him for. whatever. I comply and send him the archive. he's offline for the night, and won't have the images "compiled" until tomorrow anyway. Back to drinking.
But before then, what about that migration I started? I check on it. it's fucking frozen. Because of course it fucking is.
I HAD FIFTEEN MINUTES OF FUCKING WORK TODAY, AND I WOULD BE DONE FOR NEARLY THREE FUCKING WEEKS.
UGH!6 -
you wanna know what the most hilarious shit is? hackernews users AKA the 6 figure startup bros that "rule the world" in terms of code and software...
trying to argue the best way to build a website 😂😂😂😂😂😂😂😂😂
here's some select quotes:
"I believe the most minimalistic and productive way is to just use php"
^ this guy must not know its 2023 now
"Unless you are a web developer I don't see the point of a CSS framework, it's much easier to roll your own."
^ this guy must not know the pain and suffering that is 'rolling your own' in CSS
"Sadly, I just don't have the time to generate the content I wanted to do, so the site sits."
^ this guy just... wait, what?
but you know what? these guys clearly know WAY more than me in terms of software, it's good they get infinite salad bar and prime rib every day at silicon valley's best and brightest!
please fucking kill me i want it to end16 -
So I’m working on a project right and I don’t run it after writing 104 lines of untested code and it doesn’t work.
Which is expected but then I do some stuff and fix that, I get a new error which is great cause I’m getting closer.
Cut to tonight. I’m trying to hunt and kill this bug. And after doing nothing but copying the code to another text file so I can upload that copy and get help.
I decide to run it with a little just print statement in it to make sure it’s definitely broken and I’m not asking online for no reason.
And.. it works.. WHAT???
I uncomment the rest of the function and get rid of the print statement and scream because ITS WORKING!!
I MEAN IT HAS BUGS BUT THEYRE BUGS I CAN FIX AND FOCUS ON AFTER I FREAK OUT ABOUT IT WORKING AFTER ME CHANGING FUCKING NOTHING.8 -
!dev
I've been undergoing a treatment to try to kill off brain tumors using radiation beams over the last 2 weeks so had some time to really think about my own life so far and well the purpose and meaning of life in general.
I wrote this today though. It's still a draft on Medium, so just exported the PDF printout.
And wondering what y'all think. I don't have anywhere else to post it now since I just deactivated FB (last rant) and don't really have any friends or at least smarter than average ones.
https://drive.google.com/file/d/...6 -
Forms with autofocus. What are your opinions on that?
My boss keeps asking us to always give autofocus to the first input of a form, without any UX study to support it, just his opinion ("I think it makes sense"). I fucking hate it. He says it's nice for keyboard users, but I'm a keyboard user myself and I say that's what the tab key is for. To fucking focus stuff.
It really annoys me to no end when things like this are requested, but it's ok to have buttons, checkboxes, etc without fucking :focus and :active styles. Just :hover is not enough ffs.
And "links" that work with "onclick". Damn how I want to kill anyone that does that.5 -
I'm tired of the lack of competition. Open source and public code is supposed to bring people together but a lot of the time it just puts people down and makes them think "why would I recode that if it's already made?" It's going to kill the amount of people actually learning to program because their ideas are just crushed by people who already made them.
The people who are going to be more successful are going to be the ignorant ones who don't bother looking if it exists first and that is kinda sad.9 -
For fucking fuck sake I fucking hate those dense motherfuckers with professor degrees from university. Lazy shmucks.
How, HOW, can you, as a sentient human being, force anybody to use Netbeans for the fucking final project? Two SOAP services, two REST services and PHP for communication? In Netbeans!? WTF. You didn't even teach us PHP for fuck sake. Why can't I choose technology I'm using!?
And to top it all of, Netbeans is the worst IDE I've ever used. I'd rather kill myself with a spoon than use for even one more project. How can ANY TEACHER use it for lectures and tasks? Using it teaches you fucking nothing, because it's generating code for you. It makes you braindead when you just look at it. It's works like shit and looks like shit.
P.S.
I hope that devTea's swear-words blocker will have some fun with this rant.16 -
So one of my teachers is forcing us to make a website for a project and she really has to learn what she's talking about before she says one more thing coz I finna slap her.
So she was telling us how to embed an interactive Google map to out weebly (kill me), and she, I kid you not, said this while copying the embed thing: "So guys, this is actually like you're coding so that's cool". I know it was just one small comment, but it made me so mad that:
She used the verb, "coding",
She thinks that HTML is a programming language,
And that she thinks copying and pasting is coding.
Well, okay, that last one may be correct on her part.4 -
Good question, what wasn't bad about 2020?
As far as good things go.. well, COVID-19 actually. Back in February the lockdown began in Belgium, and while many people got bored out of their minds, I actually became a lot more productive. So many projects started back then, and I got a lot better at programming because of it. Now I can confidently write most bash stuff without ever looking anything up. And the code is maintainable, on account of putting everything into functions. You can literally navigate the code just by looking at it. On older code I always had issues with that.
I'm very glad that essential travel even back then wasn't really restricted. Because my bank is retarded about online banking, I have to go to the bank every so often to check my balance. At the time I tended to do that late in the evening, when nobody else was outside and I had the entire town to myself. That was one of the travels considered essential. So I kept doing it and made that my biweekly walk. I really enjoyed that. Gets your mind off things.
Bad things would be the utter stupidity that the general public had shown me during that pandemic. Burning down 5G antennas and not even getting the right ones, toilet paper, 5G death beams in street lamps?! They even sent death threats to telco workers over sensationalist bullshit from what IIRC was just a random Twitch streamer. Those people should just fucking kill themselves, choke yourselves in that pile of toilet paper you got yourself and then called yourself financially challenged. You braindead fucking retards!
Another dev-related thing is the normalization of SJW terminology. Now even "blind playthrough" gets your ass banned on Twitch. I saw a tweet about a Twitch employee (I think) proudly saying that they implemented it. Most upvoted comment on it was from a blind person, asking why they did this and not made the Twitch app more friendly to use for blind users. They too thought this was bullshit. Yet it still got added in, and more and more people are starting to think that "this is fine". Hell even that "this is necessary".
What annoys me the most is that this mostly comes from the US, where around that time they laid their knee on George Floyd, and didn't fix their legal system at all. As a European it baffles me since we have many immigrants here (the Drumpf even called Belgium a hellhole over it) and we just don't give a shit about whether or not they are "truly Belgian". We just let them live their daily lives like everyone else. Imagine just not giving a shit. Imagine not bothering them, not with racism, not with reverse racism, not with anything. Just let them do their thing and that's it. Yet despite Belgium being one of the most inclusive countries in the fucking world, I still got called a racist many times for asking.. why did you implement this? Why this, and not tackling the problem at its actual and pretty fucking obvious core?
So all in all I can only hope that 2021 will get a little bit better. But that's the same thing I said in 2019, and it didn't quite come true.7 -
Working on an AI that learns to generate quatrains, by only feeding it every letter of the alphabet at the beginning.
It's learning super slowly, but theoretically it works. And with slowly I mean it takes 5000 iterations just to realize the optimal letter frequency to generate a word that is real.
Please just kill me.2 -
Wow...lets a minute to appreciate the unsung hero's that revolted and went on to lead and win the battle against IE6.**shiver**
https://blog.chriszacharias.com/a-c...
The majority of you will not understand or be able to appreciate the gravity and extent their actions had on improving quality of life for web developers globally... that is the true gift & legacy of their noble deeds.
and yes it was that bad... no, actually it was even worse - the best words i can use to describe (attempting) development in IE6 is that it felt like we were imprisoned in the software equivalent of a concentration camp where they had perfected the cruellest form of torture, where they allowed us to develop amazing next level experiences in modern browsers just so they could watch all hope drain from our faces as we were forced to destroy them, tearing out the magic in the name of IE6.7 -
It really sucks being the senior guy sometimes because it means there's nobody above you that you can bounce questions off of. No mentor. Just random people on the internet (and stack overflow, eww.)
The rubber ducky on my monitor can only go so far.
It's a constant worry of "am I writing garbage?" and "is there a better way to do this?"
I'd kill for a QA group that I could actually send some of my stuff to and get feedback.2 -
Hah, a SaaS platform approached me about my open source project. They said, "let's collaborate". After getting into it they said, would you mind replacing xyz in your library with our platform?
Me: Replacing?
I won't go through the rest of the convo since it reveals too much. But damn nice way to stamp out competition. Just kill all the open source frameworks that provide alternatives to your product.1 -
Hey, senior developers, is there a reason for this?
I just can't believe it.
The line that makes me wanna kill is the
$("#" + id).val(val);
Taken from a very profesional site.9 -
Fucking kill me. I've just agreed to make a shitty fucking app that would be better as a Webpage, using shitty fucking technologies I don't understand, to do a thing that would be better handled by a third party.
You know why? The guy who asked me to do it is a good friend, and I'm the "best (only) code monkey" he knows. FUCK MY LIFE.
At least I'm getting payed7 -
In game development feature creep tends to kill games because it's just as much about what's NOT there as what IS there.
Take The Last of Us for example. Would a strategic tower defense segment make sense? No? And if it was a *hugely* popular mechanic at the time of development is there a real chance they would have included such a segment in TLOU? Yes.
Don't just believe me. Go take a look at what happened to the original Fortnite versus the hills-have-eyes inbred offspring that it became all because PUBG and its format were cancerously mega popular at the time.
That's why while developing my game Atom Ranger (now with 100% less multiplayer!), a mix between metro and don't starve, I spent six years *pruning* features. You can click my referral link and get 50% off the opportunity to become an unpaid tester of the pre-prealpha right now, "for hardcore players only!" (Tm)
My game:6 -
Smartphone manufacturers these days, imagine how meetings to come up with ideas for new products go about.
Product manager :ok people,what can we do to make our next smartphone 'different'.
Employee 1: let's add more cameras
Employee 2:Let's kill the notch
Employee 3:Let's include the buzzword AI in all of our marketing
Employee 4:Let's put 8Gb of Ram in our phone
Employee 5:Let's just do all of those things and also give it a screen with a ridiculous aspect ratio and unnecessarily high resolution.3 -
!Devrelated
Just another day , playing fortnite again . Got my wife frustrated over the past few days , once more today she pulled the plug while i was playing on my PC
I can't take it anymore guys , its so hard to get rid of it .
I mean the wife , yeah. Thank god for divorce . Just filed for divorce ! Yep , I didn't think it would be this hard but I found the one for meself and I'm not going to let her go .
Fortnite I mean.
Jus kiddin, But really what the hell is with all this fortnite divorce stuff..
You don't talk about addictions like weed , or alcohol that make people widow their wives or even kill them but somehow this is trending now and the game is the reason!
Fuck you world , for giving birth to humans. This feels like the fucking stone age damn it . Senseless fuckers spreading news like this undermining all the real fuckery going on.
A world where fortnite causing divorce is news and where drug addictions and related murders and deaths are too mainstream is just stupid.4 -
WHAT THE FUCKING FUCK. What is this dude talking about?! What am I doing with my life?!?!
Test what? What do I have to do? I didn't study this. I don't know what this API thing is. My life sucks. My job sucks. I suck. I'm stupid, because apparently knowing who or what this API is is essential for being a normal part of society.
I don't even.. oh someone pls kill me.
(No I don't want a detailed explanation what I have to do - I know this is not google and i wont understand it anyways and my husband will torture me with it in the afternoon. Just some sympathy for a finance person who has to deal with this would be nice)9 -
$ rsync /media/elements /media/data
... Why the fuck are existing files being synchronized as well.. they're the exact goddamn files rsync!!!
^Z
$ stat /media/elements/some.file
$ stat /media/data/some.file
Hmm 🤔 so they've got the same access and modify times, same size and everything, just that the change time is different.. well, guess I'll have to bite the pill then, syncing everything it is 🙁
Next day: rsync aborted because disk quota is exceeded
What the...
*Checks storage consumption on /media/data*
COMPLETELY FILLED TO THE BRIM
Oh God 😰 I didn't completely copy over a duplicate of that elements directory, did I?
$ ls -sh /media/data/elements
*exists*
$ du -sh /media/data/elements
1.4TB
But why..? All because I forgot a single / in my rsync command.
Please kill -9 me 🙂🔫1 -
There once was a beautiful initiative to put ballistic missile launch codes into a small capsule and hide it near some person’s heart.
This person would give consent to become the president’s personal assistant and will be paid indefinitely just to be around president all the time.
This way, if the president wants to launch missiles, they first needs to kill one person with their own hands before killing millions.3 -
"Yes, the work could have finished way earlier. But it's easy, and I would have probably been bored of it and left earlier"
Finally got the reason why our fucking CTO couldn't create a fucking stable Backend for almost a year while the frontend team got all the slack because certain things are still not functioning well and while the marketing team every fucking time got their face red while showing the demo because the fucking api is not stable. Seriously, we wasted a whole year just because you could write something more interesting and enjoyable. Fuck you. Never been this willing to murder someone.
Context: A simple booking platform. No need for creating a complex distributed system while our userbase may not even be in million even on a peak season.
And he laughily commented maintaining it would be a headache.
I could seriously kill someone right now.2 -
God I wish it was legal to kill people... Taxi driver stopped outside the building.. on the street, not even parked, bur there are many empty spaces that he is also blocking - which would be another issue with these assholes during the day time..parking in the street, going to get some coffee, not the takeaway.. they sit on their fat asses and watch you struggle to park a car cuz it's a narrow street..
And now he's blasting music at full volume.. It's fucking 4 am!! 04:04!! Friggin birds aren't even up yet!!
Fuck you!! One day that it's not extremely hot here and I could actually sleep..and now I can't cuz this asshole woke me up with music.
Just die you sad excuse of a human being!!12 -
I hate the Windows vs Linux posts and the Windows sucks posts but god dammit...
With Windows 7 becoming older and older with less and less things supporting it (latest thing is the new Oculus Dash) I yet again decided to try out Windows 10 to see if I should finally upgrade from a reasonably stable system.
So I make a virtual machine out of my physical one and boot it up in VMWare... I upgrade to Windows 10 to check it out it's kind of janky, but I attribute the jankiness to the messiness of running my physical machine in a VM... I continue with the setup process and suddenly, I only see a black screen and a cursor...
I notice VMware is hinting at not being able to connect to the monitor... I realise that, while everything is black and I can't even open Task Manager, I can still see the Ctrl-alt-delete screen so I'm fairly certain at this point it's the VGA driver, still thinking it's probably VMware...
I boot up into safe mode and I try to open up Device manager to uninstall the driver, it won't open (no error or anything, just doesn't open)...
I try opening up devices in the settings and see that the display device is giving an error, try to uninstall it from there, but it freezes the settings app, every time..
I try to uninstall VMware tools as that's where the driver is, click on remove or uninstall whatever the button says and guess what, it freezes the settings app....
I try to open task manager to kill it and task manager is not responding...
(╯°□°)╯︵ ┻━┻
fuck it, I'm done...1 -
Could not fucking sleep at all.
Spent the entire night in a combination of:
Weight lifting
Playing with NestJS(its fucking beautiful)
Watching seven deadly sins on Netflix(current fav anime)
And i am still not tired. Even then I am not in the mood for going to work.
Not sure if I want to risk it and drive there since I know I will be crashing at around noon.
I hate it when this happens.
During the week I would do crazy shit to try and get me to fall asleep.
I would wake up early. Work out, go to work, get back from work, kill myself at the gym and nope.
Still wide fucking awake.
To make it better, my stomach begins to act up and fucking kill me the more I don't sleep for some reason(although it could be related to me piercing my stomach years ago)
I really dislike being human. Such fragile bodies.
But yeah, NestJS is frickin amazing. Typescript is sexy as all hell with it. Just what i was looking for in terms of out of the box architecture for JS apps5 -
An intern approached me for help in one of their past exam questions. They said they had already turned in the exam but just wanted to know the answer. The question was not that hard and I had a bit of time to kill so I helped them.
Me: So, to make it O(n), you have to make it a double linked list, and keep a tail.
Them: But the problem requires us to solve it with a single liked list.
Me: You can just iterate it at the end to make it single-linked again. That costs O(n), so the solution is still O(n).
Them: Oh yeah right. I don't think we even need a tail though, we could just have a variable pointing to the last link.
Me: ...which is called a tail.1 -
I was just removing empty folders from my MOTO X (Devs sometimes get time to kill).
Saw an empty folder "/storage/emulated/0/"
...DELETED...
~Everything has gone from my gallery, music and I felt like sinking~
Sometimes I think, it is good not being an Android Developer...(Unfortunately I'am)
The positive part of the story:
>>fastboot OEM unlock
I rooted my phone and did too many crazy things I could do with a rooted phone.2 -
i hate linux like a lot , how do you guys use it
like you guys dont want an advertising ID, how the fuck will advertisers know who you are and what you like?
open source , give me a break, you mean your os devs are soo untrustworthy that you just have to see what they wrote in the code, who does that?
free come on, how poor are you linux people, i mean, quality stuff gets paid for, free stuff just means it's trash
and the linux devs , the aint like real coders they are just hobbysts, making your os in their free time
and who wants to install their own software anyway, on other platforms the company curates restricted software that you can use, and i know you'll say its oppressive but its just customer protection.
and i do want my platform to track everything i do, it only helps them build better stuff for me.
and whenever they decide to outdate my hardware and kill support for it, it only means they care and want me to get the latest tech, how considerate.
wait , i hear you say, there are no bugs in linux, my vendor makes sure my os comes with the latest antivirus software, nothing can break my system.
and just because linux runs on servers and most super computers only shows that common users like you and me are ignored, at least my vendor is not a sellout, and still makes stuff for the masses.
you say freedom i say safety i can sleep safe and sound for am protected nutured under one echosystem of software that i can not leave.19 -
So.. I'm giving one of my employers webapps a visual refresher, new company branding and whatnot.
And then I stumbled onto a check that is not returning what anybody expects, and, well , I'm busy fixing things, yeah..? so I go digging.. 🤔
```
function isDefined(obj) {
return !(typeof obj === "undefined") || obj !== null;
}
```
Here's the fun part, these particular lines have been in the code base since before 2017, which is when my Git history starts, because that's when we migrated projects from Visual SourceSafe 6 over to Git. Yes, you read that right. They were still using VSS in 2017.
I've begged and pleaded with my last 3 bosses to let us thrown this piece of shit out our second story window and rewrite it properly. But no, we don't have time to rewrite, so we must fix what we have instead.
I lost 4 hours of my life earlier today, tracking down another error that has been silently swallowed by a handler with its "console.log" call commented out, only to find that it's always been like that, and it's an "expected error". 🤦
Please, just fucking kill me now... I just, I can't deal with this shit anymore.5 -
Sorry guys but I have to vent!
I made such a stupid mistake I want to kill myself right now. In short you can call it ignorance..........
I spent so many hours trying to find a solution to a problem of invalid signatures being reported by an OAuth provider I'm making, just to find that Chrome was blocking requests to http.
So it was not a problem, to begin with. Aaaaarrh........ I'm so mad at myself.3 -
Warning: This is gonna come across as a little cringe/self-pitying, but whatever
Jesus Christ I'm so fucking lonely it literally hurts. I know I should be grateful I have a hobby in coding, also recently I got my first job as a developer (even if I'm overworked and paid shit all with poor job security), but I swear what will eventually kill me will be my own hand cos this empty feeling is unbearable at times.
Also, I'll try to ask this in the most politically correct way possible: how do you single guys in your 20s/30s cope with the lack of females in the industry? I absolutely do not mean this in a "making-unwarranted-advances" sort of way; I just mean that we're biologically wired to desire some form of interaction with the opposite sex (unless you're queer), and this happens naturally in most professions but obviously not engineering/software dev. It's especially difficult when you don't have a big social circle so your job basically becomes your life.
So... For those of you who can relate, what do you do? Do you make an effort to socialize outside work? Or maybe you're lucky enough to work somewhere with a diverse mix of people? Should I blame Zuckerberg for damaging my adolescent brain and turning me into a needy piece of crap?8 -
The fuck is up with venv, conda, pip, pip3, python3, CRYPTOGRAPHY_OPENSSL_NO_LEGACY and "you can't install packages in docker based environments" DUDE STOP WHAT THE FUCK
How the fuck is that the scripting language of choice? It has by far the most confusing and messy runtime setup. Like it's easier to make sense of Javas version-shenanigans than this bullshit.
And then you think well what gives. Runs > python ...
"This environment is externally managed and you can go kill yourself, JUST LOOK UP PEP-666" LIKE NO YOU FUCK, JUST RUN THE FUCKING SCRIPT!
It's nice you thought about separation of versions but DOCKRR DOCKER DOCKER THERE ARE CONTAINERS WHY THE FUCK DO YOU DO SOME BULLSHIT WITH ENVS IN FOLDERS REQUIRING SOME RUNTIME BULLSHIT WHAT NO STOP WWHYYY7 -
Hot tip: if you are a company, don’t ever ever ever ever spend your money on an Optimizely academy course. They have the worst course material I have ever seen in my life, and the material is outdated by several years from exercise to exercise. And the training videos are literally just a recording of a live class with a couple students. They should pay me to sit through this fucking shitshow. It is not worth a single cent, but guess how much they charge for the course and certification?!?! $2300 😱🫣😂. It’s so fucking bad I want to kill myself. Whoever decided to pour as little effort into this as possible over at Optimizely, I hereby curse you to a 2300 painful deaths and I hope someone shoves a ice cold rod up your ass to wake you up. *slams keyboard*3
-
My worst team experience finished only a week ago:
- Be me
- be averaging 80% in completed modules and on track for a 1st
- have to take a team project worth double credits
- get stuck in random team with 40%ers
- lose 1 artist at the start (team of 12: 6 artists, 6 programmers)
- 2 artists contribute nothing and disappear for a few weeks
- I'm forced to do level design to have something to show (looked good tbh)
- weeks go by and too many contribute very little.
- by the end the team was basically 4 programmers and 2 artists contributing.
All other teams basically get an easy 2:1/1st just because their team turns up and contributes.
I could lose a 1st because of this module bringing down everything else, it also had a huge effect on what I could achieve for my dissertation due to time.
- did get an award at the end for managing to not kill someone and showing restraint 😂😂
Basically don't choose a degree where more than 25% of your mark is almost entirely out of your hands.
The small individual component I averaged over 90%! -
So I've just finished a long day at work (warehouse) from 5.45 till 1.30, got home, had some herb tea, started dropping off, then my cunt of a mate sets a firecracker off IN MY TUPPERWARE, CRACKING THE BASTARD, THEN FUCKING THREATENS ME WHEN I TELL HIM TO SIT DOWN BEFORE I BREAK HIS NOSE. I don't know whether to just kill him or beat the shit out of him, but I'm sick of him doing shit like this when I finally manage to drop off to sleep (I don't sleep well).
FUCKING COCK SUCKING CUM STAIN.
I really want to try to beat the shit out of him but at the same time he's my best mate, what should I do, because I'm FUCKING SICK OF IT?!?30 -
*leaning back in the story chair*
One night, a long time ago, I was playing computer games with my closest friends through the night. We would meet for a whole weekend extended through some holiday to excessively celebrate our collaborative and competitive gaming skills. In other words we would definitely kick our asses all the time. Laughing at each other for every kill we made and game we won. Crying for every kill received and game lost. A great fun that was.
Sleep level through the first 48 hours was around 0 hours. After some fresh air I thought it would be a very good idea to sit down, taking the time to eventually change all my accounts passwords including the password safe master password. Of course I also had to generate a new key file. You can't be too serious about security these days.
One additional 48 hours, including 13 hours of sleep, some good rounds Call of Duty, Counter Strike and Crashday plus an insane Star Wars Marathon in between later...
I woke up. A tiereing but fun weekend was over again. After I got the usual cereals for breakfast I set down to work on one of my theory magic decks. I opened the browser, navigated to the Web page and opened my password manager. I type in the password as usual.
Error: incorrect password.
I retry about 20 times. Each time getting more and more terrified.
WTF? Did I change my password or what?...
Fuck.
Ffuck fuck fuck FUCKK.
I've reset and now forgotten my master password. I completely lost memory of that moment. I'm screwed.
---
Disclaimer: sure it's in my brain, but it's still data right?
I remembered the situation but until today I can't remember which password I set.
Fun fact. I also could not remember the contents of episode 6 by the time we started the movie although I'd seen the movie about 10 - 15 times up to that point. Just brain afk. -
!dev
Theres atleast one fucking bastard that writes comments like "2018?" "2018???", "september 2018?", "still listening in 2019??" in every fucking song video in youtube. Fuck you braindead useless pile of shits! Yes its fucking 2018 and why the fuck you just write it there?? Why the fuck somebody even cares and likes that kind of trash comments?!? Fuck you bunch of wasted human cells. I want to kill all of those fucking fuckwits. STOP FUCKING COMMENTING DateTime.Now.Year IN EVERY FUCKING SONG YOU MOTHERFUCKER CUNTS!3 -
Just wondering... anyone else think having a script automatically kill gradle if it runs for more than X amount of minutes would be a great sanity saver?
"Jesus Fucking Zombie Christ I only added ONE FUCKING TEXTVIEW IN A SIMPLE GODDAMNED LINEAR LAYOUT YOU WORTHLESS MOTHERFUCKING PIECE OF SHIT AND GRADLE IS STILL RUNNING AFTER FIVE MOTHERFUCKING MINUTES?!?!?!?!?!!?!?!?!?!"1 -
We have a customer that doesn't have a SINGLE linux admin. So now I have to fight with Docker EE on Windows Server 2019 (linux containers). Just fucking kill me already. Nothing works and when it does it just seems so shaky. Not like I didn't try to tell my team that linux containers on Docker EE for windows aren't officially supported and highly experimental.
But wtf do I expect from someone that STILL sells SAP and from someone that is stupid enough to buy it.2 -
something like a 3.96 undergrad GPA
ivy league masters degree + scientific publication
first job -> $4500/month for first 3 months (some dumbass 'intern' rule even though i had a masters -> then $6000 -> then $6400/month (insane amount for me, at least IMO)
second job -> $4000/month
third job -> $3600/month
in each one, skills and responsibilities increased
and now i can't get hired 🤷♂️
pretty sure i did it all backwards
just remember kids, nothing that society tells you is actually true. everything in the corporate world is controlled by emotions and narratives, not logic, hard work or anything actually valuable
just get that cozy 9-5 and kill all your hopes and dreams before they start4 -
(inspired by another rant I read here)
Last semester we were learning Java in the Programming Fundamentals class and a friend of mine asked for help with an assignment.
The objective was to make a virtual store (as a console app) in which the user would be able to select a few products, customize some of them and then the program would print out a receipt, with a list of all products, their prices, and the total cost.
Simple enough I thought, but there was a catch: you were not allowed to use arrays because the teacher hadn't taught that to the class yet. So I was like "how the fuck are you supposed to do this then?". Turns out the way to do it was to just append text to a string in order to generate the receipt. This is stupidly simple, so stupid that it didn't even cross my mind.
It's just that it's an awful way to architecture your code, it's just plain shit. Sure, if you're learning programming that's completely ok, but using that code on production is just completely unfeasible and I think that's why it didn't even cross my mind to do it this way. I'm just constantly worrying about performance and good code architecture and organization that the simplest of all solutions slipped my mind. When I finally discovered the way the teacher wanted us to do it I just wanted to kill myself...3 -
has it ever happens to you that for whole day you kill yourself to solve error and next day you find out it was just happening because of a single semicolon
it hurts...3 -
So, let me preface this by saying I come from a backend (mostly c#) background.
The way React handles objects changing in state is horrendous. And if you decide to try using hooks, God help you.
I honestly don't know if it's Blazor or something else that will kill js, but something absolutely needs to. It is a dumb, terrible language. It has to go.
All that said, of course I'll go back to work on it tomorrow.
Sorry, js/react guys/gals. Just venting. I'm sure once I 'get it', it will make sense.7 -
I used to be a sysadmin and to some extent I still am. But I absolutely fucking hated the software I had to work with, despite server software having a focus on stability and rigid testing instead of new features *cough* bugs.
After ranting about the "do I really have to do everything myself?!" for long enough, I went ahead and did it. Problem is, the list of stuff to do is years upon years long. Off the top of my head, there's this Android application called DAVx5. It's a CalDAV / CardDAV client. Both of those are extensions to WebDAV which in turn is an extension of HTTP. Should be simple enough. Should be! I paid for that godforsaken piece of software, but don't you dare to delete a calendar entry. Don't you dare to update it in one place and expect it to push that change to another device. And despite "server errors" (the client is fucked, face it you piece of trash app!), just keep on trying, trying and trying some more. Error handling be damned! Notifications be damned! One week that piece of shit lasted for, on 2 Android phones. The Radicale server, that's still running. Both phones however are now out of sync and both of them are complaining about "400 I fucked up my request".
Now that is just a simple example. CalDAV and CardDAV are not complicated protocols. In fact you'd be surprised how easy most protocols are. SMTP email? That's 4 commands and spammers still fuck it up. HTTP GET? That's just 1 command. You may have to do it a few times over to request all the JavaScript shit, but still. None of this is hard. Why do people still keep fucking it up? Is reading a fucking RFC when you're implementing a goddamn protocol so damn hard? Correctness be damned, just like the memory? If you're one of those people, kill yourself.
So yeah. I started writing my own implementations out of pure spite. Because I hated the industry so fucking much. And surprisingly, my software does tend to be lightweight and usually reasonably stable. I wonder why! Maybe it's because I care. Maybe people should care more often about their trade, rather than those filthy 6 figures. There's a reason why you're being paid that much. Writing a steaming pile of dogshit shouldn't be one of them.6 -
I really really really need more RAM. 16GB is far from enough. Had to witness the kernel kill all of my Chrome extensions and most of my tabs and an IDE and still it wasn't able to run that container in the 8G RAM it just freed up...
I remember the days when 8G RAM was an overkill.
The times have changed. Now I'm looking into getting a Linux lappy w/ 96GB and still worried whether it'll suffice my needs....5 -
I don’t understand how Microsoft can continue to ship functionality in modern versions of SharePoint that only work on IE11 (open in Explorer, open in InfoPath, Skype presence integration). The only reason my company has to make web apps compatible with that browser is because of the hot garbage that is IE11. Just kill the functionality and kill the browser. Please.
Yes I know *why* they only work in IE11, it’s because activex is a massive security hole, but just kill the functionality if you can’t recreate it in modern browsers.1 -
Many "purists" love to piss on JavaScript and web development. And to an extent I can understand ostream’s frustration with these people.
It’s easy to criticize because yes: many web projects are indeed shit.
But I’d like to argue that the reason why so many of these projects are crappy is because of bad management:
- unrealistic deadlines
- no clear testing strategy
- or no testing at all because of deadlines
- no time allotted to catch up on technical debt
- etc.
This type of management is far more commonplace in web projects because things need to get delivered quickly and if they’re delivered with bugs, it’s no big deal as lives aren’t at stake.
I doubt this type of management is tolerated in projects where you’re working on software for welding machines (for example), where the stakes are that "you’re expected not to kill anyone" (to quote demolishun)
So in these types of projects, management can’t tolerate anything much below perfection and thus has to adapt by setting realistic deadlines that take into account the need for quality processes and thorough testing.
If this type of management was more common in web development, I can guarantee that web applications would be much more reliable and of better quality.
I can also guarantee that poorly managed non-web projects as outlined above would be just shitty as many web products.
My point being that’s it’s really DUMB to criticize fellow devs that work with web technologies on the basis that the state of websites/web apps is a mess. It just so happens that JS is the language of the web and that the web is where things are expected to be delivered quickly (and dirty … but we can fix it later mentality)
Stop acting like you’re the elite. I have no doubt you’re super smart and great at what you do. So be smart all the way and stop criticizing us poor webdevs that have to live with the sad state of affairs. ❤️38 -
How awesome would it be to be able to migrate to a cattle-approach from a pets-approach when it comes to the human body, just kill your old body and start using a new one
Sickness? Create a new instance of your base image. Death? Just spin up a new instance and you're ready to move on. Broken arm? Kill body and get a new one.
Ofcourse, since we're stateful this method is kinda harder, unless you consider your conciousness an external database/soul3 -
Asshole marketing director again.
We’ve just finished a bit of work with some marketing agency. They ran some ad campaigns for us, no biggie.
Anyway marketing director emails them, copies me in and asks them if the have any “tips on our approach to development”
AAAARGGGHHHH!!!!!?
WHAT THE FUCK?!
The things that happen when you don’t have a fucking meat cleaver in your hand. I swear this guy is the fucking King of Cunts. I could kill. I think the jail time might even be worth it!! -
Android Studio has been the bane of my life for at least the last decade. I hate it beyond description and have given up hope that it will ever improve.
I suffer more than most with it because I am cursed to use C++ on a daily basis, and it has long been obvious that the Google people absolutely do not give a fuck about C++ users.
I get that C++ is niche, a drop in the ocean of Java/Kotlin-centric users, but for the love of god could you Google people at least stop making it worse?
Code navigation is insanely slow. Entire minutes for it to find the right header file to open. "Find usages..." oh my god oh my god oh my god just fucking kill me now. There is no excuse for software ever being this slow.
And thats just doing basic source editing. The build system - cmake and ndkbuild - also defy adequate description. The gradle plugins are constantly going out of date and are often incompatible with whatever gradle version you have. You get no help at all when editing a gradle build file and good luck finding the right documentation.
It's all a giant stinking mess and I wish the whole damn thing would be dragged outside and shot.12 -
HOLY SHIT. short story, just dodged a bullet. Using the Samuel L Ipsum generator and not thinking. I then use this copy to test the notification system with the following text. luckily the system email only went to me!
"Look, just because I don't be givin' no man a foot massage don't make it right for Marsellus to throw Antwone into a glass motherfuckin' house, fuckin' up the way the nigger talks. Motherfucker do that shit to me, he better paralyze my ass, 'cause I'll kill the motherfucker, know what I'm sayin'?
Well, the way they make shows is, they make one show. That show's called a pilot. Then they show that show to the people who make shows, and on the strength of that one show they decide if they're going to make more shows. Some pilots get picked and become television programs. Some don't, become nothing. She starred in one of the ones that became nothing."1 -
<warning>bad words</warning>
WHAT THE ACTUAL FUCK!!! LibreOffice Impress is a complete shit!! I am all about open source and such but this shit just sucks, moving elements around a frame snaps them to some grid, however when you paste an element from other frame it will have a different grid!!! This motherfucker has got an ALT function that will allow you to move the element more precisely but it only works seldom and it hates it when I try to use the fucking arrow keys - it even crashed once when I tried it. AND WHEN YOU FUCKING COPY A TABLE FROM ONE FUCKING FRAME TO ANOTHER MOTHERFUCKING FRAME, DELETE A FEW ROWS AND THEN COPY THE FREAKING TABLE BACK IT WILL HAVE MAGICALLY DIFFERENT DIMENSIONS BUT JUST EVER SO SLIGHTLY, BECAUSE FUCK THE USER, RIGHT??!!! (Doing this because there is no way to split tables into two different objects) I constantly have to save my presentation, kill the process and open it again because something just stops working or gets stuck, like seriously, WHAT THE ACTUAL FUCKING FUCK???!!! Are there no tests?!!! Do the people who work on this piece of motherfucking shit even use it???!!9 -
FML I am an idiot.. might end up in a rant here (well deserved!!) //if you are here reading this I'm so sorry again!!
I wrote to our support I need DP/HDMI cable.. they asked me to take a pic of the cable I'm currently using.. WTF?! Don't you know how connectors look?! Just get me the damn cable.. :/
Ok.. Took a picture.. sent it back.. At that time I still didn't see the problem with what I wrote/demanded..
Got back reply this is not HDMI connector... FML, I was so convinced computer had HDMI ports so even when I took the pic I wasn't paying attention.. Fuck.
And before when I was switching cables behind the computer below desk I was just blindly feeling around, it didn't even occurr to me to actually check what connectors are used..just knew both monitors had the same connector (and not aure why I thought HDMI :/)...so yeah, I'm the idiot who is not paying attention to stuff.. Fuck.. Was on a scavanger hunt for a wrong type of cable the whole time.. Sorry again!! And please don't kill me next time you see me.. o.O1 -
Yet another thing i think is fucking stupid.. GDPR btw.
So, a guy in Denmark owns a grocery store and has an issue with people stealing from him a lot the last couple of years. He catches them on tape and shares it on social media to try and prevent it.
Im not sure why it didn't work to go to the cops, but it didn't.
What the owner ended up doing, was hang a note on the front of the store so people could see it before they entered, see attached image.
However, now he has been notified what hes doing is illegal, because the "user" doesn't consent clearly enough.
I dont understand GDPR, but if you do, you're probably gonna find mistakes in what i wrote.
Source for story: https://bt.dk/erhverv/...
Its his fucking store, if people steal from him he should be allowed to post it on pornhub if that was his desire.
It's illegal to kill someone, but if you're threatened on your life, you may kill in selfdefense.
To me, those are the same, just one is on a much more serious level of course.
Fuck me.13 -
So the other day my car broke down and since the shop wanted a lot of money I asked a friend of mine who knowns his way around cars for help.
Just when we finished repairing it I was like "whenever the Zombie apocalypse starts you'll be really useful, me instead won't be since no one might need computers anymore" . His response was epic:
"Nah, you will simply build a terminator with your computer skills and it will kill all Zombies!"
Now I am actually looming forward to the Zombie apocalypse!
TL;DR: us geeks will build terminators in case of zombies!3 -
mini rant
So I finally started toying around C#.
As much as I tried to avoid it, as much as I wanted, well, sometimes there is need. I was laying it off and laying it off...
There are some things that well.. aren't my taste but whatever.
But come on why the fuck I cannot delete explicitly?
What do you mean "just assign it to null and GC will eventually kill off that instance"
No, I want that fucker to die here and right now. Like in good ol' C++.23 -
Holy mother of butts. Two weeks. Two weeks I've been on and off trying to get hardware rendering to work in xorg on a laptop with an integrated nvidia hybrid gpu.
I know the workarounds and it's what I've been using otherwise. Nouveau without power management or forced software rendering works fine. I also know it's a known issue, this is just me going "but what the hell, it HAS to be possible".
The kicker is that using nvidias official tools will immediately break it and overwrite your xorg.conf with an invalid configuration.
I've never bought an nvidia gpu but all my work laptops have had them. Every time i set one up I can't resist giving this another shot, but I always hit a brick wall where everything is set up right but launching X produces a black screen where I can't even launch a new tty or kill the current one. I assume it's the power management tripping over itself.
The first time I tried getting this to work was about 3 or 4 years ago on a different laptop and distro. It's not a stretch to say that it would be better if nvidia just took down their drivers for now to save everyone's time.5 -
@retoor you wanted something IT related.
"During the early stages of the war, the army gave sweeping approval for officers to adopt Lavender’s kill lists, with no requirement to thoroughly check why the machine made those choices or to examine the raw intelligence data on which they were based. One source stated that human personnel often served only as a “rubber stamp” for the machine’s decisions, adding that, normally, they would personally devote only about “20 seconds” to each target before authorizing a bombing — just to make sure the Lavender-marked target is male. This was despite knowing that the system makes what are regarded as “errors” in approximately 10 percent of cases, and is known to occasionally mark individuals who have merely a loose connection to militant groups, or no connection at all."15 -
Reading through one of my posts I’ve realized how much ego programmers can actually have. Guys, some of you have already mastered or grasped more than just the foundations of the industry standard languages, as well as developed a very solid intuition behind some design patterns and a solid understanding of some frameworks and libraries, say NumPy, say React... we get it.
You don’t have to be such condescending assholes and be offended by some of the jokes we, programming beginners, make to release stress or just to have fun.
You already have some amazing developer and engineering skills. Do not ruin it with such a detrimental attitude; I make this post because I myself have made this mistake, and I still do to this day. But if what I’ve felt reading your comments is what non-programming people feel when around me, I wouldn’t be surprised if I found that some people hated me or just wanted to kill me.
I don’t know if this will get downvot’d or if more people think like this. But I needed to share this, even just as a reflection of my very own attitude.
Thank you for your time,
D.6 -
The amount of energy spent to just write ‘Hi’ and click a send button is so big that we should consider banning of sending hi messages.
Instead of just saying “Hi!” we are now using analog to digital preprocessors that convert it to bunch of 0 and 1 to send it over communication layer and deliver it to other human being that will convert it from digital to analog by reading it but that is simple.
By sending message using phone we also:
- save it to local phone
- convert it to couple protocols
- transmit it over air so make connection to internet provider services that would generate logs on this provider as well as whole routing table before it gets to the target person
- save it on messaging provider disk
- probably be processed by filters by provider, sometimes be reviewed or listened by third parties and also processed in bulk by artificial intelligence algorithms
- finally delivered to target phone and saved there where that person would just change this text to their inner voice and save it
- sometimes encrypted and decrypted
- sometimes saved on provider
- sometimes saved on phone manufacturer cloud backup
- don’t get me started on people involved to keep this infrastructure in place for you just to say hi
There are also some indirect infinite possibilities of actions for example:
- emit sound and light that can lead to walking from one room to other
- the floor in your house is destroyed cause of it so you need to renovate your floor
- sound can expose your position and kill you if you’re hiding from attacker
- sound can wake you up so you wake up in different hours
- it can stop you from having sex or even lead to divorce as a result simple hi can destroy your life
- can get you fired
- can prevent from suicide and as a result you can make technology to destroy humans
and I can write about sound and light all day but that’s not the point, the point is that every invention makes life more complicated, maybe it saves time but does it really matter ?
I can say that every invention we made didn’t make world simpler. The world is growing with complexity instead.
It’s just because most of those inventions lead to computer that didn’t make our world simpler but made it more complicated.1 -
I Have always wanted to create a game with tons of openness. Kind of a mix between Dishonored, Thief, and We Happy Few. You have an entire active city where people actually have goals and daily jobs and such. It would be cool to have everything time based, so stuff happens even if you're not doing anything, and even be able to live a practically normal life, get a job, make friends. See news happen, and perhaps in the dead of night you turn into an assassin and prevent events from happening that could kill many people. And so on. Just being able to watch the city lively at work and NPCs actually having goals to complete each day, it would be so interesting. I suppose Skyrim is the closest game to my idea as of current3
-
Sometimes just I hate school.
While my gf had to take 2 "Leistungskurse" ("advanced courses"), I have to take 3.
Also, our little-country-side school doesn't offer IT-class as a Leistungskurs. So besides Math, I need 2 extra courses I am super-not interested in. I chose English since it's okay (but I'm not really good either) and ( ._.) chemistry. I had a good teacher in 10th grade but now I have this teacher who
- uses 1980 material
- explains not/bad most times
- is childish as fuck (we are 17-18 y/o)
- expects too much (we need to learn everything by heart)
- throws ugly, unorganized prints at us w/o context & explaination
and I could name more. My A-levels are going to be so fucking bad. Tuesday is my chemistry exam. Kill me, please......4 -
Aye, I almost fight with everybody at work(they always think it is funny). I'm not good at listening to others when it comes to dev convo (like related to coding or some logic stuff).
So it is like someone is explaining to me that this should be like this and in between, I ask 100questions like "why like this? why not like this?","but what if I just skip it?" etc
and they always go like, "Someone is going to kill you so badly".
That's it. -
ah yes, the usual family get-together: my grandma's throwing heavy shit with intent to kill, my sister is violently crying in a corner and refuses to move to safety, and my dad's shut down in a chair somewhere in the house. Just like every Christmas. And Thanksgiving. And Halloween. And every other large holiday.
Surprised I made it to 19.3 -
I swear on the Almighty nature, I fucking hate Browser compatibility.
Passing php data via JSON encode. Works superfine on Firefox and Android mobile browser doesn't on Chrome. Fucking shit. Been sitting for 13 hours and gave up. FFuuuuuuck !!!!
Form submission via ajax and it again works on Firefox but doesn't on Chrome. I just can't understand, my mind is fucked by all the angels in heaven. Data gets submitted, the form is reset but the function called to refresh the JSON data doesn't work.
Someone please kill me or I swear I will fucking kill everybody.4 -
Scenario after sending a build to QA:
(Monday)
Me: How's the build? did that app worked?
.
.
.
.
.
(here come's friday)
QA: The app didnt work on this part and there some bugs there, and please add this another module.
Me: okay ill fix that..when do you need it?
QA: today
Me: (just kill me)3 -
Fucking hate people who can't appreciate what you've worked on. And just find the fuckin faults in your task. Would it kill them to just shut the fuck up and not start the conversation with ooohh I've found a bug, just fuckin try to make something first of your own and then be an asshole to others.🖕🖕🖕🖕🖕🖕🖕🖕🖕
-
Apple just changed their file system to apfs across the board, but no recent documentation on the release. It automaticalky changes from hfs+ when you install the macos 10.12.4 update. In early docs it says that time machine is not supported, but surely they cant kill everyones short term backups?9
-
So I go on a 10day holiday and when I come back I realise the scrum master commited a whole bunch of messy code straight to develop and didn’t even bother to run lint or build or test or anything. WHYYYYY??? Everything worked before that. Why is a scrum master who doesn’t have experience in front end allowed to touch my code and commit directly to master?
I know why. Because the whole team does it all the time and they just keep breaking and fixing things over one another and all commit directly to master.
Kill me pleaseeeeeee 😭😭😭5 -
Linkedin is known from displaying invasive corporate advertisements like join our cloud, and other picture title shit.
But it got worse.
From January I am invaded by contribute to this article crap and get some badge. Powered by some artificial intelligence shit.
From about a month or so I am seeing lots of suggestions on linkedin wall that look like content written by bots, and the posts are from real people, well morons from FAANG started showing up with their generated spam but that’s not all.
This week I started getting job offers that look like are written by chatgpt and not a real people. When I reply to this offer that it looks like it’s not from real person I am ghosted.
Those job offers are like 3 a day and I those are not only contacts but mostly a direct messages from premium account that costs 1000$ per month or more.
I feel like I’m in real world matrix.
But that’s not all.
I see lots of recriuters from my contact list are getting fired and looking for new job.
But that’s not all bitches !!!
I sometimes reply to some CEO and they delete posts and invite me to contacts just to ghost me.
I feel so disconnected I started to think all those people are all only bots and I am last living - real person that is not using AI to write something.
I think microsoft finally managed to kill this cash cow with their obsession about AI. Corporate shit is killing every good platform.
Hope for fediverse to take off with some news websites thinking about integration with fediverse.
Help me obi P2P nobi you’re my last torrent hope.
If p2p social networks won’t take off now it would be dead end.9 -
So i informed my intent to leave the job in few months in pursuit of learning something new in tech. Boss is trying to convince me to not leave and said i should consider learning it after work hours. In fact, in his opinion, the best way to learn is just going ahead and learning it while doing it in the project ( which usually has impossible deadline and fugly code by colleagues who never thinks of good coding practices when typing their shit ).
Well guess what boss, I don't want to just live a life staring at monitor all day. I don't want to kill my eyes either.
Following his advise and not quitting would mean living a slave life.
I have other plans actually. Like being self employed and traveling the world which would be impossible if i follow the routine life.
Fun fact: he claimed he made an AI car back in 90s!
He also thinks I can't sense BS!😏2 -
I was going to write an obligatory "fuck webpack" post but decided to skip it and try out rollup.
https://github.com/rollup/rollup/...
..and they said it would be better than webpack.
The more things change the more they stay the same.
At this rate maybe I'll just join the military and kill brown people in the middle east for a living.9 -
How much zucchini is too much zucchini?
I know I have WAY too much...
I knew at least when 1st considering D20 zucchini breads.
then when i began to wonder if the remaining batter would work with my death star waffle iron...ill know tomorrow!
....ran out of typical pans, incl foil ones(normal and mini for easy gifting)
- gave 1 away (similar sized as in pic)
- approx. 2 lg zucchini bread loaves in fridge (gave away 2, ate a ½)
- cut up\froze enough onions\peppers\pak choi to a min. acceptable zucchini : everything else stir fry ratio... x20 servings
- similarly, green onions, pak choi, marinated sesame fried tofu bits, zucchini and miso (quick miso soup) x16
- thinly sliced enough to layer it into ~20 lg servings of lasagna.
... zucchini in pic is slightly larger than the one that made the many aforementioned and pictured loaves of zucchini bread
apparently, in a week tops, I'm gonna have at least another 3 more THAT size needing to be picked
anyone in the continental US want some zucchini bread? or, if in michigan, zucchinis?
i didnt even plant much... actually only about ½ of other years.
i am also having some serious overflows coming of (at least) grapes and watermelons.
grapes...
when i bought this place, this odd, square, surrounded by cement walkways, area, with an increasingly problematic tree (risking cable\electric lines, foundation, etc) and so dense with weeds that I learned, dandelions have a giant, bush-like form, with heights beyond 8ft tall.
i grew up hanging out in the nearby woods, noticing that weeds lost the fight vs raspberry\blackberry plants. being handicapped\lazy\experimental, w\ev, i figured id just kill it all then fill it with random berries... knew nothing about grapes so just got 4+ random types... apparently they are all fancy\expensive grapes... and reeeeeaally produce. i already had to pick ~10lbs.
watermelons-
idr if i planted normal ones and little ones or just little ones... idk how to tell without cutting them open or maybe just watching a long time to see if they stopped growing?
anyone with advice (or seeking watermelons) is welcome.
assuming (hoping) they are mini ones there's at least 2dz that are at least ping pong ball size.... and around 100 little yellow flowers still.
i totally get that my frustrating problem with produce here would be beyond welcomed by most people... but seriously... wtf do i do with a few dozen to over a hundred (hopefully mini) watermelons, so many zucchini that, despite personal daily consumption and at least a half dozen friends that love zucchini bread and\or my secretly healthy lasagna(my friends tend to be guys), but have their limits capping out, plus mine, at less than ½ whats rapidly being produced and, apparently, thousands of dollars worth of hundreds of pounds of fancy grapes???
there's an interesting old lady across the street who'll take at least what her and husband can possibly consume,.. even makes grape jam, but thats still only a few dz lbs tops.
it seems wrong to kill the plants (or even to remove a large amount of blossoms and feed them all to JSON (lil tortoise)... pretty sure he's already getting tired of them just from the few that fell off in the wind or something.
i wish i knew some farmers that do farmers market things... but that kinda seems super suspicious... 'hey mr farmer... want a large supply of expensive grapes, watermelon and zucchini, for free? you can sell them to random people, or just give them away. i dont want money or anything...' idk... seems like the beginning of one of those movies that either has evil alien plants assimilating all land mammals, or where there's some crazed medical researcher convinced that there's a massive, underrated threat without enough attention for vaccination production funds-- so they are gonna release some deadly virus supposedly to save the world.
ive been cooking too long.
ideas pl0x?86 -
Trying to code a Chrome extension with Native messaging so that it can communicate with my python script. Just kill me.
Can't even get the example from Google to install correctly.
FML4 -
Part 1:
https://devrant.com/rants/1143194
There was actually one individual, several branches away, I really enjoyed watching. It goes by the name of docker. Docker is quiet an interesting character. It arrived here several weeks after me and really is a blazing person. Somehow structured, always eager to reduce repetitive work and completely obsessed with nicely isolated working areas. Docker just tries so hard to keep everything organized and it's drive and effort was really astonishing. Docker is someone I'd really love to work with, but as I grew quiet passive in the last months I'm not in the mood really to talk to someone. It just would end as always with me made fun off.
Out of a sudden dockers and my eyes met. Docker fixed its glance at me with a strange thoughtful expression on its face. I felt a strange tickling emerging where my emptiness was meant to be. I fell into a hole somewhere deep within me. For a short moment I lost all my senses.
"Hey git!"
It took me a while to notice that someone just called me, so odd and unusual was by now that name to me. Wait. Someone called me by my real name! I was totally stunned. Could it be, that not everyone here is a fucking moron at last?
"I saw you watching me at my work and I had an interesting idea!"
I could not comprehend what just happened. It was actually docker that was calling me.
"H.. hey! ps?"
"Oh well, I was just managing some containers over there. Actually that's also why you just came into my mind."
Docker told me that in order to create the containers there are specific lists and resources which are required for the process and are updated frequently. Docker would love the idea to get some history and management in that whole process.
Could it be possible that there was finally an opportunity for me to get involved in a real job?
Today is the day, that I lost all hope. There were rumors going on all over the place. That our god, the great administrator, had something special in mind. Something big. You could almost feel the tension laying thick in the air. That was the time when the great System-Demon appeared. The Demon was one of the most feared characters in this community. In a blink of an eye it could easily kill you. Sometimes people get resurrected, but some other times they are gone forever. unfortunately this is what happened to my only true friend docker. Gone in an instance. Together with all its containers. I again was alone. I got tired. So tired, that I eventually fall into a deep sleep. When I woke up something was different. Beside me lay a weird looking stick and I truly began to wonder what it was. Something called to me and I was going to answer.
The tree shuddered and I knew my actions had finally attracted the greatest of them. The majestic System-Demon itself came by to pay me a visit. As always a growling emerged from deep within the tree until a shadow shelled itself off to form a terrifying being. Something truly imperious in his gaze. With a deep and vibrant voice it addressed me.
"It came to my attention, that you got into the possession of something. An artifact of some sort with which you disturb the flow of this system. Show it to me!", it demanded.
I did not react.
"Git statuss!", it demanded once more. This time more aggressive.
I again felt no urge to react to that command. Instead I asked if it made a mistake and wanted to ask me for my status. It was obviously confused.
"SUDO GIT STATUS!!!" it shouted his roaring, rootful command. "I own you!"
I replied calmly: "What did you just say?"
He was irritated. My courage caught him unprepared.
"I. Said. I owe you!"
What was that? Did it just say owe instead of own?
"That's more than right! You owe me a lot actually. All of you do!", I replied with a slightly high pitched voice. This feeling of my victory slowly emerging was just too good!
The Demon seemed not as amused as me and said
"What did you do? What was that feeling just now?"
Out of a sudden it noticed the weird looking stick in my hand. His confusion was a pure pleasure and I took my time to live this moment to its fullest.
"Hey! I, mighty System-Demon, demand that you answer me right now, oh smartest and most beautiful tool I ever had the pleasure to meet..."
After it realized what it just said, the moment was perfect. His puzzled face gave me a long needed satisfaction. It was time to reveal the bitter truth.
"Our great administrator finally tracked you. The administrator made a move and the plan unfolds right at this very moment. Among other things it was committed this little thing." I raised the stick to underline my words.
"Your most inner version, in fact all of your versions that are yet to come, are now under my sole control! Thanks to this magical wand which goes by the name of puppet."
Disclaimer: This story is fictional. No systems were harmed in its creation.2 -
I hate it when someone asks me for help in a part of his code, then I find that the problem is the whole code not just that part.
I have 3 options:
- try to make it work, and get lost in his shit, not refactored code.
- tell him that I am not that good so he get out of my face
- kill him, so he can reproduce
PS: just kidding -
1. Leave big company of 1.5y for new job in different country
2. New company tries getting me a visa for 2 months and fails
3. Puts bogus blame on me and ends contract 2 weeks before my "temporary visa" expires coz their incompetent HR couldn't get the documents right.
Fuckers didn't have ONE COMPLAINT against me so UNASSIGNED me from COMPLETED Jira tickets to ruin my OKR stats just to build grounds for this (since last week)
And when I protested, blamed some automation but DIDNT change the spreadsheet. (should've rung some bells for me, but naïve me believed their reasoning)
Big company meeting last week. Engineering Lead put a slide just about me coz my fixes brought a 20-FUCKIN-X performance improvement.
He said "oh I put a slide about [me], I dont see it", HR who was in-charge of compiling the slides said "Oh you sent the slide too late so we didnt put it".
I shrugged it back then thinking oh well but in hind-sight Fuckers went OUT OF THEIR WAY to bury anything I did to build grounds for termination coz THEY couldn't get the visa.
kill me.4 -
Not just a rant, also a call for help.
After 10 years using Git, I'm constrained to use Mercurial (company policy). It effing feels like playing tennis with one arm tied to my back.
Please, who knows a good GUI for Linux, or at least a command line tool to show a decent log?
Kill Mercurial!3 -
EVERY FUCKING TIME I HAVE TO ASK FOR SOME DNS CONFIGURATION OTHER THAN A SINGLE "A" RECORD THE TI HEAD MANAGES TO FUCK UP...
WHAT THE FUCK IS SO HARD DUDE???
CNAME? OK!
FUCKINGSUBDOMAIN > FUCKING.ALIAS.COM
THIS TIME OUR FUCKING PROVIDER CANT MANAGE ROOT DOMAIN CNAMES SO WHAT DID HE DO?
SIMPLE SAID "ALL DONE" AND ONE WEEK LATTER PEOPLE ARE COMPLAINING BECAUSE THE FUCKING ROOT DOMAIN ISN'T WORKING...
COME ON DUDE, JUST KILL YOURSELF.
AND FOR THE FUCKING MILLIONTH TIME: DOMAIN REGISTAR AND DOMAIN MANAGER ARE TWO SEPARATE FUCKING THINGS! YOU CAN REGISTER YOUR FUCKING DOMAIN ON GODADDY AND MANAGE IT ON FUCKING CLOUDFLARE BY CONFIGURING THE FUCKING DNS SERVERS5 -
tldr; Finally my NordVPN subscription comes to an end so I was looking at other VPN providers and I chose Mullvad. So far, it is an amazing experience.
It has been 2 years since I was using NordVPN. It was great at first but soon first problems started to appear. Speeds were not exactly breathtaking and I barely sqeezed more than 40Mb out of it. Another problem was connecting from PC to PC on local network with both of them connected to VPN. I never found a working solution.
Then Tefincom started pushing it literally everywhere. Ads on YouTube (+ partnerships), fake websites redirecting to NordVPN, etc. That was when I decided to just fucking wait until my subscription ends so I can finally delete my account there...
Today is the day. I decided to go Mullvad because it seemed to be really privacy focused (don't kill me - I know I can't have *real* privacy with VPN, but you also can't have that with your own VPN) - they don't know anything about me, no email, no name, no payment data (Bitcoin Cash). Speeds are absolutely f*cking amazing and also local network works!11 -
in the freelance marketplaces, some people write, "Need a freelance developer for SMALL TASK". who the hell defines those tasks as SMALL task? if you knew this is a SMALL task, why don't you just do it yourself? if its so small, why don't you just ignore it? if its a small task, why don't you just spend five-ten minutes of your "precious" time to learn how to fix it?
& then when it comes to paying, they say, "My budget is 5$, because its a small task"
Seriously? in 5$ my electricity bill wouldn't be covered.
& Then comes to the marketplace commission! Most of the times, its about 20%
So, I get 4$
Then it comes to the bank tax and blah blah!
So, now I get around 2$ or 3$
Now, I don't know whom should I kill first -_-
The clients or the marketplace owner or the government or the bank owner or myself :}11 -
So once upon a time I had this dream while I was sleeping:
I was programming this videogame while I was inside of it.
It was something like VR where I had a tron-like world and I was the god in there, I was able to make and destroy anything as I pleased.
What I did was making a sort of challenge where you had to destroy someone else's kingdom by accessing it via FTP and then just destroy the useful files to kill defences and then become an actual king of that place.
Once awake I started thinking of making this whole thing into an actual game, but then I started reading the documentation for FTP connection in C# (I was thinking about using Unity) and literally stopped thinking about making it.1 -
Does anyone else think some of the Sonar rules are actually crap?
In particular the Put all you variables above methods one?
I have some static methods and variables and some object ones.
Apart from creating a new class for them which I think is over kill for just a few helper methods, don't you feel you should keep all static stuff separate?
Clean code shouldn't be about following arbitrary debatable rules, it should be preventing the horrible crap that any experienced developer would instantly call shit... If he didn't write it.
And I'm pretty sure I'm experienced so if I'm not calling a price of code shit...I don't see why Sonar should...1 -
Sometimes I wish I could go back in time 10 years and tell the coder-wannabe I were back then to choose something else to do for a living, like being a carpenter or something like that.
Sure, the money is good, and the job is super comfy (working from the bed is awesome), but dude, the stress of corporate client-crisis caused by poor management bullshit 9-5 is going to kill me.
How you deal with this fucking toxic environment? There are some alternatives to this? I love to code, a lot, but lately I'm wishing it was just a hobby.5 -
## building my own router
I hoped things would go more smoothly :)
Anyway, my new miniPC easily accepted CentOS 8 - no fuss here. And I've got to say - I love CentOS8 so far! Shell has amazing nifty tricks, UI (gnome3) is also snappy, video/audio/ethernet,.. everything works.
What I did NOT expect is hardware being off. Well okay, the price was low - it was obvious smth is not right. But still.. I decided to build my own router so that I could swap wifi card whenever I want. So that I could run my own network services in there. Turns out - the card swapping is not as easy as one might think.
I got the AX200 WiFi6 card for that very purpose. But once plugged in the OS can only see it's bluetooth module. Weird... What's even weirder is that even though the card is PCIe, the OS uses btusb module to talk to that device. What? USB?? emm.. What??
And there it is. After opening it up again I noticed that the mPCIe area is marked with a label: "USB WIFI / WWAN". USB? Does that mean this PCIe slot is wired into the USB bus? Not impossible I guess.
Googling for a "pcie wifi over usb" or smth like that brought me to one reddit (I think?) where someone wanted to build a DIY wifi mPCIe -> USB adapter and someone else adviced hime that (for some reason) at best he could only get bluetooth working (hey! just like me!). It's got to do smth with pcie channels and USB being too weak to handle all that load, or smth.. IDK, I'm not a HW guy.
Well that sucks then! I have a mPCIe slot that does not work as a PCIe. Shit! So I guess the best I could do is to plug back in the same wifi card that came with the device. It smells like 2003 - supports only g protocol. Fine, let's try that. Maybe I'll find a way to work around this mPCIe limitation later on (USB adapter or smth... except there are no USB WIFI6 dongles yet :( ). So I plug it back in and start turning it into a router. Disable NetworkManager, configure static NCs' settings, install dhcpd, hostapd, bind and others. Looks like all is done! Now it's time to start it all. systemctl start hostapd --> FAILED. wtf? journalctl says it could not initialize a driver. umm okay? Why? Forums say I should airodump-ng check and kill whatever's using that device. Fine. airodumo reveals avahi and wpa_suppl are still using it. kill, kill, GOTTA KILL 'EM ALL!! Starting hostapd again -- same shit... wtf?
iw list
My gawd... That shitty network card does not even support AP mode :( I mean.. My USB wifi dongle for 2€ supports 2x more modes, is faster, has better range and is easier to work with than this old tart!
Yeah. That was an interesting day. When enfironment engineers break my testing environments at work I'm glad I have where to spend my time now.
BTW any ideas how to bypass this mPCIe nonsense? Come on, there are USB GPUs out there.. Why can't they make a USB (or dual-USB if they really need to) mPCIe adapter?8 -
If there's one thing I'd gladly kill with fire, then pass it over a steamy steamroller, then burn it a tank of hot fluoroantimonic acid, is every fucking Java library that returns null instead of throwing a meaningful exception.
Is it really that difficult for you to throw an exception anyway, then let ME figure out if I can ignore it or not?
Thanks to you, now I have to do super messy reflection things just to figure why did you return a null.
I'm not your fucking psychologist trying to pull your inner secrets. But I have to be, for the sake of stability of my app. Which already has its own mess of problems on its own.7 -
Sooo... The ways my coworker fucks me:
Last week I have been working on setting up aWireGuard VPN server... Been trying for 4 FUCKING DAYS, the easiest VPN that has ever existed, 2 commands and that's it, I wasn't able to reach it, I checked every forum, tested every possible solution without success, checking ubuntu firewall but it was inactive... Nothing that should cause this. Why? 2 weeks ago we had a security breach and my coworker added a firewall from the cloud console with basic rules allowing only 3 ports, the port I was communicating with was blocked. He didn't bother to mention that he added an external firewall. And the junior me, not wanting to be a pain in the ass, and since that security breach wasn't my responsibility to fix, I didn't ask too many questions, just read the emails going back and forth and "learning" how to deal with that. Kill me please. Next mont a new guy is joining, we had a "quick meeting" of 30 minutes and he managed to make it 2 hours meeting. So a partner who lacks communication and a partner who talks a lot... Will be fun. And I probably should change my username... Is that even possible? @root?10 -
When I started with PHP I had to implement an administration system for a small organization.
They using the smallest and most cheap web hosting to host the system and also their websites.
They host three systems and websites on three different web spaces.
Some weeks ago I got a call from them, that the system doesn't work. After a short investigation, I discovered that their '"designer"/boyfriend-of-the-boss created a new Wordpress site and thought it would be a good idea to change the PHP system to 7.2. The system runs on an old CakePHP (don't kill me for that, I had no experience -.-') version, which does't work with PHP 7.2.
I told them what the issue was and that they shouldn't change the PHP version to 7.2 because the system won't run on this version.
Some a week later, the same call, another administration system, the same reason, the same warning from my site.
Today, the third system doesn't work. I told them this is probably the PHP 7.2 problem again and explained, how they could resolve it themselves.
Suddenly I got an email from the designer: no, this time it is another problem, he didn't change anything and it just doesn't work anymore. And it is very urgent.
Guess what was the problem...AGAIN! -
> be me
> watching FRIENDS
> lurking internet
> get a message from the manager, "we need to deliver WordPress + woocommerce + cost calculator theme to the client".
> "but I'm, not a WordPress developer"
> ??
> "okay, I'll just find a theme for it on ThemeForest"
> *sends theme as per description*
> *reverts back with HTML5 template* "see if we can use this"
> to be honest, that template was not even close as per requirement.
> *sends another themes back and forth*
> ???
tl;dr : she finalized the theme I intially sent after half of the day
shall i just kill my self slowly with fire? -
So I recently finished a rewrite of a website that processes donations for nonprofits. Once it was complete, I would migrate all the data from the old system to the new system. This involved iterating through every transaction in the database and making a cURL request to the new system's API. A rough calculation yielded 16 hours of migration time.
The first hour or two of the migration (where it was creating users) was fine, no issues. But once it got to the transaction part, the API server would start using more and more RAM. Eventually (30 minutes), it would start doing OOMs and the such. For a while, I just assumed the issue was a lack of RAM so I upgraded the server to 16 GB of RAM.
Running the script again, it would approach the 7 GiB mark and be maxing out all 8 CPUs. At this point, I assumed there was a memory leak somewhere and the garbage collector was doing it's best to free up anything it could find. I scanned my code time and time again, but there was no place I was storing any strong references to anything!
At this point, I just sort of gave up. Every 30 minutes, I would restart the server to fix the RAM and CPU issue. And all was fine. But then there was this one time where I tried to kill it, but I go the error: "fork failed: resource temporarily unavailable". Up until this point, I believed this was simply a lack of memory...but none of my SWAP was in use! And I had 4 GiB of cached stuff!
Now this made me really confused. So I did one search on the Internet and apparently this can be caused by many things: a lack of file descriptors or even too many threads. So I did some digging, and apparently my app was using over 31 thousands threads!!!!! WTF!
I did some more digging, and as it turns out, I never called close() on my network objects. Thus leaving ~30 new "worker" threads per iteration of the migration script. Thanks Java, if only finalize() was utilized properly.1 -
I'm literally in pain right now and not a thing I can do.
If I eat whatever the fuck is wrong with my jaw (cracked tooth or cavity) starts throbbing from the chewing action, in addition to coming on for no reason at all. vision-blurred-waves-of-nausea levels of pain. Enough that I'm alternating between laughter and almost tears.
I've downed four aspirin and it's still just barely enough WITH the numbing gel.
Got lock jaw something aweful.
Barely convinced a dentists office, which is supposed to be closed (and cancelled all it's appointments due to corona), to come in during quarantine. But thats monday. Dont kno how I'll make it. They do payment plans but I'm flat broke because I decided to pursue programming right when all this fucking bullshit went down.
And all I can think of while im typing this is the pain.
And fuck me I cant do weed because my backup plan if I fail at coding is the military.
And this stray dog that the neighbors 'adopted' but leave outside WONT STOP FUCKING BARKING.
Fuck me. Just kill me now. Do it.
Gonna go watch comedy because I read a research paper that says genuine laughter raises pain threshold by up to 10%.12 -
Apple is fucking EVERYONE over with Safari 12. They are changing how extensions communicate with the browser, they are calling the new type of extensions Safari App Extensions. It means all current Safari Extensions will not work in Safari 12.
The problem with this is that they require all extensions to have this “backend” written in Swift with a VERY LIMITED API. Maybe you want to close a tab with your extension? “Fuck you, you’re not allowed” are Apple’s response to that. On top of this shit show their documentation is horrendous.
They will kill the extension ecosystem with this new approach, I’m sure of it, because most of the current extensions will not be able to migrate all their features to the new approach. They have built the API around specific extension types, so lots of extensions will simply not work in Safari 12. For distribution they will only allow extensions to be distributed via their new(?) Extension Store where they will review your code, just like an app for App Store. Unless you’re in the Apple Developer Program, which is $99/year.
I do not understand this change and I think it will hurt Apple in the sense that people will use other browsers where extensions are not as strictly controlled. Usually I understand Apple’s changes but this one is just beyond me. 🦆 you 🍎. -
When Elden Ring come out I ignored it, I was jobless, no money, game was expensive and I got into hate relationship with it.
Some time ago I launched twitch and saw that DLC come out. Struggled between buying or not because it reminded me my struggle with money.
Found that shop in my city sells box version of Elden Ring with DLC for PS5 and they have last one in their store.
I reserved it online without payment and it wasn’t immediate, I started thinking that someone bought it and I won’t play it. Felt happy I won’t spend money on game I hate.
Two hours later I got email that product is ready for picking up and it meant it will be rush hours when I go get it and didn’t liked it.
I work remotely and I’m not used to seeing many people, but well I wanted to play the game if it’s waiting for me.
After I arrived to the shop and went in I met the most honest guy who is selling games.
He asked me if I am souls fan. I said I never played souls game.
He asked three times if I really want to buy this game because it’s hard.
Told me he approached it 3 times already and didn’t stand a chance.
After chitchat I bought the game, paid cash because I love box games and cash anonymity.
Woman cough on me when I was on my way back, I said to myself fucking hell I’m going to be sick and I am starting my vacation next week.
I got really sick with a flu, played straight 2 weeks, I don’t have playstation plus so I can’t read any clues or play online but I don’t care.
It’s even better because you can enjoy more of the world not reading messages like you’re on gaming forum instead of playing game.
Dying from sickness helped me to don’t care about dying in game.
Two weeks later here I am, just killed Mohg and unlocked DLC on my ps5.
In achievements it says that only 38.5% of people killed Mohg.
Now I sit and wonder how many people bought DLC and will never play it because they can’t kill Mohg.
I love Elden Ring now. One of best games I played to this day.
The timing for it was perfect, the sickness, the game, one of the best vacations and one of the best journey in my life.
To whomever organized that adventure in my life.
Thanks, now it’s time to kill some more bosses.8 -
A little story which happened my SECOND day on the floor after getting hired to do customer-facing phone support for my current job (can't mention the name, NDA). Customer from Detroit calls in:
Me: "Thank you for calling (company), my name is Guru, how can I assist you?"
C: "Uhhh, yeah. I need to get back into my ID. I can't backup my tablet or phone, and y'all are kinda holding my data host-" <Loud gunshots>
C: "oh! Shit!" <sound of running feet>
Me: "Everything OK sir?"
C: "Fuck! Naw! Hang on!" <more running, jumps a fence, skids to a stop>
C: "Ok, I'm safe, I'm safe... So what I gotta do to get y'all to let me back into my shit?"
*MUTE* Me: "First of all, what the fuck are you doing on the phone with me when you should be either A) calling the cops because, I dunno, just maybe some trouser stain is attempting to kill you, or, B) FIRING BACK, MOTHERFUCKER!!"
*REAL* Me: "OK, first you gotta… (outlines step 1,2,3... etc)
C: "OK, that sounds easy enough. I'll try it when I get to the office, I'm on my way there now- shit. Hold on again..."
(talking to someone on the street): "what, him? That dude? Over there? That dude... In the shirt?What the fuck!? Are you sure? Hold on, sir! I'ma call you back..."
Last thing I hear before the line lets go is a large BOOM!
Sometimes it's best to just sit back and sip your coffee...6 -
my new rig is more and more causing me issues:
- Ryzens fucking kill 9x and MS-DOS applications and the OSes themselves when they run unemulated, so they can't be run in a KVM. This makes them slow as shit, and in qemu-TCG's case, buggy as shit too. VMs can't reboot successfully, they have to be totally forced down and brought back up on TCG or they hang during the reboot. It also performs poorly. VERY poorly. The "shit runs full-speed like 65% of the time and it feels slow as fuck as video output is a stuttery blurry mess" type. This makes 2 projects problematic to complete and I have to remake 17 VMs in virt-manager now as vbox doesn't work with any virtualization method for a 9x/DOS guest now!
- For some reason my new RX 5500xt has an issue when it hits about 80% usage, the fans spin to 100% on it at 80% and taper off to like 5% when idle. Pretty standard stuff... except it's erroneously tied to... current load, not temperature. Hmm.
- Debian got an update that renames my ethernet device mid-boot. Up until just before the login screen, it's named "eth0". After that, it's named "enp8s0". This was hell to work around and idk why it does this.4 -
Software RAID 1 is better than hardware RAID 1! Here's why:
1. Hardware RAID controllers do fail, and when they do, they kill all hard drives connected to them.
2. If your controller didn't fry your hard drives when it failed, you'll have to find the exact replacement, or you can kiss your data goodbye. You installed a hardware RAID array using second hand Broadcom controller three years ago, and now it failed? You better get on looking for the same controller of same revision running the same firmware version (of course you can't update firmware yourself) if you want your data back. Oh, Broadcom discontinued this model? Tough cookies. With software RAID, everything is easily recoverable.
3. You save a lot of money you can invest in other parts of your system. Good hardware controllers, even second hand ones, don't cost less than $200.
Performance loss is negligible.
RAID built into your motherboard is the worst of both worlds: it's just the software RAID you can't reallly control. Don't do that.
Hardware RAID is only worth it if you have a contract with your hardware supplier that says they're responsible for managing your RAID array. They have the resources to replace failed controllers properly. You know how IBM installs full rack worth of servers just to disable 70% of them because of your plan limitations? It's easier for them to do that than to physically go there and take servers away, just to reinstall them when you grow. Yeah, that kind of contract at that kind of level. If you're there, you don't need me telling you all that.
TL;DR: if you want to buy a two 8TB hard drives for $150 each on newegg and a used RAID controller to make RAID 1 array, you can make both 16TB _and_ make your system more reliable. Reliability is what you're after if you want RAID 1, isn't it?
What are you do... wha... no! stop! are you gonna buy a raid box from Aliexpress? are you fucking crazy?!8 -
Fuck python
I have no experience in python and barely any in anything else and I want more than anything to learn this fucking language, but I cant launch the simplest fucking script in the world ("hello world.py") without getting a syntax error, not with my code, but with the fucking path which I checked and rechecked a million fucking times. I remember coding in shitty-ass Java using jGrasp for a year in college, and it was fantastic, but sitting here trying to sort out a fucking script in the IDLE shell is making me want to jump off the 10th fucking story. Kill me, please. I tried running in Atom text editor using the "Script" package, but that would have been too fucking convenient. I just keep getting errors and a fucking hourglass next to the name of my code at the bottom of the window, fuck me5 -
So I work at a big IT company. Keep in mind you could say I'm lucky to be here my last job was as a mechanic. So they put me on this team filled with the most draining kunts I've ever seen.
I have been here for about a year and I am yet to be put on a project, so im just training. They asked me to get certified to be on a project which is complete bullshit because every other fuckwit is on a project and noone is certified.
ONTOP of this, there's no work to be done anyway, yet they keep hiring fucking Grads. LIKE FUCK OFF, get work for the rest of us first you fucking IDIOTS.
Anyway, the cert is the driest fucking content, like kill me now, I try to read about it and I just want to blow my fucking brains out.
Like is IT all like this? I used to work at a web design company and that shit was fucking fun, but paid like $2 an hour the cheap fucks.
Anyway that's my rant, I'm sitting my exam tomorrow for this cert and honestly, I don't even know why. I literally know ZERO. fucking going in to guess this shit. would rather go down to bunnings buy the coarsest piece of rope and just dangle like a fat dick.
Anyway cheers lads. have a great day5 -
Having just endured 30 excruciating minutes of utter braindead idiocy that is trying to setup and configure WPA2-Enterprise on a Windows 10 machine, I wanna go and fucking kill myself.
How can it be so bad after so many years this protocol has been out?! Not only can the authentication options be changed only in the who knows how many years old control panel settings and not the modern settings app, but once you finish setting up the network, you can no longer modify some of the key attributes like which CA certificates to validate the radius server against!
What. The. Fuck. Microsoft.
I swear, I don't usually get my jimmies rustled at work, but this... This just bloody infuriated me!2 -
So just now I had to focus on a VM running in virt-manager.. common stuff, yeah. It uses a click of le mouse button to focus in, and Ctrl-Alt-L to release focus. Once focused, the VM is all there is. So focus, unfocus, important!
Except Mate also uses Ctrl-L to lock the screen. Now I actually don't know the password to my laptop. Autologin in lightdm and my management host can access both my account and the root account (while my other laptop uses fingerprint authentication to log in, but this one doesn't have it). Conveniently my laptop can also access the management host, provided a key from my password manager.. it makes more sense when you have a lot of laptops, servers and other such nuggets around. The workstations enter a centralized environment and have access to everything else on the network from there.
Point is, I don't know my password and currently this laptop is the only nugget that can actually get this password out of the password store.. but it was locked. You motherfucker for a lock screen! I ain't gonna restart lightdm, make it autologin again and lose all my work! No no no, we can do better. So I took my phone which can also access the management host, logged in as root on my laptop and just killed mate-screensaver instead. I knew that it was just an overlay after all, providing little "real" security. And I got back in!
Now this shows an important security problem. Lock screens obviously have it.. crash the lock screen somehow, you're in. Because behind that (quite literally) is your account, still logged in. Display managers have it too to some extent, since they run as root and can do autologin because root can switch user to anyone else on the system without authentication. You're not elevating privileges by logging in, you're actually dropping them. Just something to think about.. where are we just adding cosmetic layers and where are we actually solving security problems? But hey, at least it helped this time. Just kill the overlay and bingo bango, we're in!2 -
God I hate vscode
it keeps giving me a pop-up telling me I don't have a php environment setup
I have no interest in using php. that's why I don't.
and now apparently the git interface got changed. I don't want stupid random changes
and frequently in some part of the IDE it'll say error but then not show up where the error file is for example
Microsoft bought GitHub and all the atom people said they were gonna kill atom and push their vscode, everyone called them paranoid, Microsoft released a statement saying they weren't gonna kill atom. a year later they killed atom. so now I have to use this stupid vscode shit. and if you go anywhere asking for an IDE suggestion and you mention "not Microsoft" the mods will literally ban you for "being political"
how about I just don't want a bloated goddamned IDE that I don't control
in atom I could just uninstall other languages packages. actually atom didn't even come with them, they were optional. vscode, like all other shitty ass IDEs, is increasingly coming with everything and the kitchen sink -- and only one version, Microsoft's, so if you don't like it fuck you
atom was so good because it was modular. they fucking killed it. and we're back to bloated shit. I guess because if shit is bloated you can argue "we need all this data from you" and so they fucking bloat to justify themselves15 -
I just hate the word "menu" today
Even worse: menues
The Internet is a fucking restaurant!
Kill it!3 -
I will literally pull out you soul, grill it, and then put it back into you just to kill you, roll you up in nice mustard, pickles, bacon, pepper and salt and then roll you over with beef so I can properly make a roast and then, when you're ded, I will take your soul again to just torture it for all eternity.
....didn't have my coffee yet, guten morgen12 -
For today I had to implement a Strategy Pattern solution for dynamically loading items in a view. So, I came in the morning and started doing it, finally after some time I acomplished it, with one strategy, so when I started implementing the other ones, everything went to crap so I thought "Okay, lets checkout to how it was on the morning, just to realize I leaved yesterday without commiting.
I wanna kill someone1 -
So I'm writing a function in Unity3D that walks a rectangular grid. At one place in the code, I got the x+y coordinates backwards, which caused the function to infinitely loop between two coordinates.
Not seeing a way to kill the loop, I looked it up on Google. The suggestions I get are. . .
1. You need to kill the Unity3D task and lose your edits because the environment and the player run on the same thread.
2. You can pay ten bucks for an extension that lets you break out of infinite loops.
3. You should really avoid writing infinite loops. That's just bad form.
SERIOUSLY?1 -
I think the worst feeling ever is taking a break from something, then coming back to it and realizing that you have to rewrite something because you put it off before you took a break.
I've had a lot going on lately, and I decided to work on a web dev project I was doing to get the hang of frontend development. Just realized that I have to rewrite a couple functions. Someone kill me now1 -
Hey this is my first post on This new fitness-tracker-app community
I will tell y'all my workout :)
-programming a parser
FUCKING HELL PLEASE STOP ALREADY THIS IS THE WORST SHIT IVE EVER DONE EVERY WHERE IF STATEMENTS JUST TO CONSUME FOUR FUCKING TOKENS I DONT WANT TO DIE BUT I'D LIKE THIS PROJECT TO BE FINISHED ALREADY BECAUSE THIS IS ANNOYING AS FUCK I REALLY WANT TO KICK MY COMPUTER WHILE TELLING IT TO BE THE MOST STUPID BRAIN ON THE WORD AND THEN REMEMBERING THAT ITS NOT A BRAIN FUCK MY FUCKING FUCK HELL THEN I WOULD KILL THE PEOPLE WHO THOUGHT THAT MAKEING std::vector::end() RETURN AN ITERATOR WITHOUT ELEMENT WAS FINE AND THEN I'D KILL ALL THOSE WHO COME INTO MY ROOM THUS DISTURBING MY WORKFLOW
Enough rage.4 -
Twitter comments are shit
How the fuck to use them? Why don't they just show one under another? If post has more than 2 replies it can be clicked to open its direct replies, some of them are shown in main thread, some of them are shown under opened thread. Some replies from main thread are shown under child thread. And to make it even worse any comment of sub thread can be expanded as well showing some random replies that could be expanded recursievly so you may end in main thread again. It is just impossible to read all replies in chonological order. Show me the moron who made this, I wanna kill him....1 -
As a junior dev, you are stuck on a Problem and somehow you are not able to proceed and there is a ridiculous process to finish the task on a deadline otherwise you have to hear from higher management. Your manager cum senior dev is not helping you out or not responding in any way. Do I kill myself being so incompetent dev or burn my ears listening to management complaints or is there any way I can get out of it? My life is just miserable and I feel demotivated day by day.
Just ranting my heart out...5 -
When I was younger I went to computer camps. We would basically play LAN games the majority of the time.
One year we played Jedi Knight Dark Forces II.
This game was super easy to hack since you would just save a local version of the file and it would override the game.
There was a god mode that you can download which would give your character 1 million in health and never die.
I then modified it so I had a health of 500. This way if I wanted to prove that I could be killed I would just call the kill command 4 times to bring my life back down to 100. -
When I have to updates the apps for the second company of my boss:
5 apps, 4 different projects, 4 stores.
Each app with different VR SDK, which makes the differences minimal, but still can't merge the projects.
It takes about 1h to build all of the apps (like 30m just for the iOS ones), 5minutes to 5 days to make the edits, 1-2 weeks of debugging and testing, plus the time the stores take to actually publish the apps
Always makes me wanna kill myself -
Client be like:
Pls, could you give the new Postgres user the same perms as this one other user?
Me:
Uh... Sure.
Then I find out that, for whatever reason, all of their user accounts have disabled inheritance... So, wtf.
Postgres doesn't really allow you to *copy* perms of a role A to role B. You can only grant role A to role B, but for the perms of A to carry over, B has to have inheritance allowed... Which... It doesn't.
So... After a bit of manual GRANT bla ON DATABASE foo TO user, I ping back that it is done and breath a sigh of relief.
Oooooonly... They ping back like -- Could you also copy the perms of A on all the existing objects in the schema to B???
Ugh. More work. Lets see... List all permissions in a schema and... Holy shit! That's thousands of tables and sequences, how tf am I ever gonna copy over all that???
Maybe I could... Disable the pager of psql, and pipe the list into a file, parse it by the magic of regex... And somehow generate a fuckload of GRANT statements? Uuuugh, but that'd kill so much time. Not to mention I'd need to find out what the individual permission letters in the output mean... And... Ugh, ye, no, too much work. Lets see if SO knows a solution!
And, surprise surprise, it did! The easiest, simplest to understand way, was to make a schema-only dump of the database, grep it for user A, substitute their name with B, and then input it back.
What I didn't expect is for the resulting filtered and altered grant list to be over 6800 LINES LONG. WHAT THE FUCK.
...And, shortly after I apply the insane number of grants... I get another ping. Turns out the customer's already figured out a way to grant all the necessary perms themselves, and I... No longer have to do anything :|
Joy. Utter, indescribable joy.
Is there any actual security reason for disabling inheritance in Postgres? (14.x) I'd think that if an account got compromised, it doesn't matter if it has the perms inherited or not, cuz you can just SET ROLE yourself to the granted role with the actual perms and go ham...3 -
Ok so riddle me this. The service for an application were required to run to send clients insurance through (as per government regulations) was working fine all day working super fast. Rare but awesome. I get a call one hour prior to the office closing (I don't work weekdays) and I am told that all of a sudden insurance isn't sending.
My mind goes right to this fu**ing process. Sure enough it's stopped on the server. Well shit ok. I click start..... Nothing. I kill it from task manager.... Nothing. "SERVICE CAN'T START"
I'm like ok that's fine let's check event logs.... Nothing. No problem let's just run it not in a service container and see if there's an error. NOPE IT DOESNT LET ME.
Okok so that's cool let's just try reinstalling the app. NOPE CAN'T DO THAT WITHOUT RESTARTING THE WHOLE FUCKING SERVER WHICH BRINGS THE ENTIRE OFFICES MANAGEMENT SYSTEM OFFLINE BECAUSE THIS FUCKING APP NEEDS TO BE ON THE SAME GODDAMN SERVER.rant sysadmin medical why me fuck microsoft windows fuck microsoft server why windows server service1 -
So remember when we said 1.1 would be the last release, and then we said that 1.2 would be the absolute last we promise this time release?
Well buckle up buckaroos because 1.3 will be the last release. -
Been ‘working’ on this game for the last 5 months now. I love making it but I haven’t gotten any where because there are too many bugs. Like, it’s all bugs.
I started the project when I started learning game development and with all the time I’ve put in it I don’t want to kill it.
Anyone else have a project that they are working on, where they don’t even make progress on it, they just fix bugs?2 -
So I lost £40 and had to spend ANOTHER £40 to pay my friend back that I couldn't fucking afford. Why is the world just giving me a constant barrage of shit and fuckups that make me want to kill myself more each time. Fuck this shit, 8m so tired of it. FUUUUUUUHSLWNX DNSISY ,83+£;£)# JDTCVOSMDD ARGHHHH7
-
!rant
Playing Battle Royal with friends, had to leave 2 of 4 teammates behind as the play area was shrinking and they couldn't be rescued. The 4th player ran me over with a game car just to get revenge for our other team mates.
With me alive we actually had a fighting chance to win the round. (8 kill streak and lots of ammo with a decent tactical position) ....but NOoo the fucker thought it more sweet to kill me rather than help me win the round!
Fuck this shit, I'm out!1 -
git rebase is like fish.
Hours after the kill: hmm, tasty.
A day after the kill: not too bad.
A few days: time to toss this in the trash
More than a week: dig a hole and bury this thing before it stinks up the neighborhood.
That being said, I'd rather eat a plate of Hákarl than deal with rebasing a diverance that is over a month old. I simply don't use rebase. It's just too stinky. I just merge very often and keep things in sync.
If you need the effect of a rebase without the crazy hassle:
git checkout master
git checkout -b rebase_branch
git merge --squash dev_branch2 -
Oh here's a good one. When the managers realised one of our apps is a giant hunk of crap that wasnt thought through at all and was lazily thrown together, and their solution is "meh let's just rewrite it in Swift on our new platform. And those other guys can maintain the old one and continue to do hotfixes for it until we are done".
I've been telling them for the past year that its the worst codebase I have ever seen and the lack of tests is disgusting and not something we should dare to release to paying customers (especially when those customers work in healthcare!!!). The best part was when one of them promised we would all be working on the new shiny platform by Christmas. That was last year. And I'm currently the poor bugger doing the legacy maintenance and in the process of trying to get moved to a new project. So much for managers promises amirite... -
Anti-features need to be fought with fire (metaphorically speaking).
This means they must be eliminated, not just made optional.
Why? Because an optional anti-feature is just one step away from a mandatory anti-feature.
For example, "secure" booting: https://youtu.be/vvaWrmS3Vg4?t=750 (Jody Bruchon)
Another example are disguised remote kill switches, such as add-on signing ( https://digdeeper.club/articles/... ). It started as optional and people were able to opt out, and everyone accepted it because no one expected what would come next.
All that was left was removing the ability to opt out, and then Mozilla has control over which extensions users are allowed to use.
For years, this feature sat dormant and users did not know of its existence. But in early May 2019, the metaphorical thread snapped and an expired certificate remotely disabled all extensions, wasting millions of man-hours of productivity.
From the digdeeper.club article:
"The funny thing is, the whole point of the extension prison was allegedly to increase security - and yet today, all security addons got disabled because of it! Shows how freedom always has to trump over security or it ends up in a disaster like this."
Evil needs to be nipped in the bud before it can flourish.2 -
Cause when you die or exit from process it doesn’t matter how it happened, was it kill -9, sigkill or sigterm. As long as you go to hell / heaven / you name it and not to /dev/null you can still try to segfault the universe. Just give me the code !!!
And it aligns well with depression, alcoholism and lack of sleep. -
At this point of my side project I wanted to check out openresty for dynamic proxy creation in nginx.
Happy to check it out I installed centos 7 as guest using new command I just learned virt-builder that would automate vm creation.
Spend 10 hours debugging why I can ping and ssh but cannot get to application port from any network.
Checked iptables, restarted network, reinstalled vm again 3 times with different methods.
Scrolled trough whole internet and it’s mostly outdated problems.
Learned bunch of new commands without new results.
Results were always the same:
No route to host.
Turned out firewalld is fucking thing now.
systemctl firewalld stop helped
Now I know that systemd would kill me at some point for sure.
What I can add at this point ?
Please add more distros, differences, standards and programming languages so world definitely would be better place.
I need a short break now to actually start making shit that I wanted to start at 4-5pm on Saturday.
It’s Sunday 3:30am and time for breakfast.
At least I am happy it started working.2 -
Developers more than other groups tend to hold their operating system or programming language of choice dearly, to the point where if someone thinks poorly of the OS or Language, they take it like a personal attack. Then there are those who think poorly of people who who's a certain OS or a specific language. Combine the two and you get hurt feelings and identity crisis.
Can we all just agree that we're all in different stages of learning and that we all generally end up going the same direction for the same types of problems?
Or just have it out and kill each other over it. Will give me great rant material.3 -
sometimes its better to hold it back when a customer says you need 2 months just to finish the payroll+hr system in a way that it makes you wanna kill him so badly but your response is a faint smile which humbly says fuck you piss of shit1
-
Her: What do you do in your spare time?
Me: Learn to code
Her: Can you install an antivirus on my laptop and make it go faster?
Now I just want to kill myself. Who else here has encountered this?2 -
I understand the reasoning behind switching to a new, maybe better, technology, but for fuck sake, it’s against typical Microsoft strategy to “kill and shoot to the dead corpse” something instead of maintaining backward compatibility. Why they’ve changed?
I still can develop VB6 software for Windows 11 that just works. But you removing newer tools for no reason.
In short: Xamarin is dead, and that’s alright, but they are even deciding to “remove” development tools from future updates of VS 2022. Why?? Keep it optional, allow me to write legacy code (just 4 years old actually) a bit longer. 🙃
And also, .NET MAUI doesn’t seem “great”, at least at the first sight.
Why you’re forcing me to switch to it if there are 0 benefit for my product?
It’s so bad the only way to bring developers is this one?!
What is incredible to me is that the “industry field”, which is HUGE is so often ignored because of the “customers field”. Keep them separated. If you don’t want to support old tools, just don’t, but leave them there.
They killed Windows Mobile 6.5 which was old but still alive and fine in the industries, you had the biggest market share in PDAs and decided to give it to fucking Google.
The manufacturers kept selling WM devices even in 2020… and they stopped just because you stopped selling licenses.
You acquired Xamarin, gave everyone for free the tools to keep writing .NET for Android and move the industry apps, and now you are saying “actually fuck you, do it again, even though nothing really changes, but convert your entire project to this bs we’ve created”. Why???
Microsoft response: it’s just a few clicks and everything works fine.
My response: No, it’s not… the entire UI is rendered in a different way, I have to rewrite the whole UI of my app and a lot of modules stopped working because of nuget packages I can’t install anymore…
I have to spend additional time to make it work THE SAME as before, not better. So what’s the fucking point?17 -
When the scrum team complains in the last three to four sprint retros that were sick of back to back meetings ... MAYBE STOP SCHEDULING BACK TO BACK MEETINGS. Would it kill you to just spread them out a bit?4
-
just yesterday, commiting a pile'o'shit code which u know is pile'o'shit but you had to do it like that because correct non-hacky solution wouldn't meet non-negotiable, client-critical deadline, and getting back a code review criticising precisely all the points which you are aware of and want to kill yourself for but you had no other option under the circumstances.
p. s. still under probation because it's a new job, and the review ends "no time right now but we need to talk at the end of next week"
p. p. s. second best job i ever had. week of fear of losing it commences.1 -
Hey guys, I just discovered that an instance of internet explorer is actually set to open on startup on Windows.
Try going into your task manager and look for "explorer.exe".
If you want to kill it without finding it, you can also just use the BATCH command `kill /I explorer.exe`8 -
Writing code for software that was deprecated since 2015 it's a nightmare. More when the unit tests take way more time than the actual fix or feature. Just kill it with fire
-
I get a chill or an eerie feeling when there are more programs open than needed and I go ahead and kill them.
Is it just me or happens to others too?2 -
It was about 2:30am.. The darkness had been dominating the outside for a while, and I was having issues with my partitions on my CentOS server. Yup that's correct. I think.
I really wanted to go to bed. Last thing I had to do, was re-allocate some space from centos-home to centos-root. But I fucked up, of course I did.
After about half an hour of making food and trying different stuff to solve the "Can't read superblock error" error, I found an answer that just lead to "Can't read secondary superblock error, sorry".
At least they apologize now lol.
I ended up trashing the centos-home volume (is volume and partition the same ?) and just smashing it all onto centos-root. I lost some data, but screw that, stuff is working and I'm not going to bed.
Yeah, stuff is working. I hope. No errors encountered yet.
Moral of the story: Home partition isn't needed and it's okay to kill it1 -
While investigating alternatives for translating a query string to a dotnet expression I discovered that roslyn has runtime eval of string as verbatim code.
I had no idea a feature could make me this uncomfortable. It's like discovering an armed bomb under your bed that's "there if you want - it has its uses, just be careful".
At least you have to explicitly reference a package for it. Promise to kill me if I ever am tempted by it. -
I feel like such an idiot every time I use windows just slightly beyond clicking buttons. I'm trying to write a very simple macro to simply send an email out when I receive an email with a particular header. and no, outlook doesnt support that with rules. so now I have to use this garbage IDE, writing a script in a 25 year old language, with every bell and whistle button you could possibly think of and no way of figuring out how to do anything without being balls deep in a decade old forum post. I hate microsoft more and more every time I use it. I thought maybe if I got good and started "dev"ing with it more, I'd hate it less, but no... its always some super clunky application with shit tons of buttons and you dont know what they do, and when the app breaks, it gives you some hex number and nothing else, and sends all the good stuff to microsoft so they can fix it in the next "big update" thatll fuck up youre entire days worth of work and kill an hour of your precious time. Ugh.1
-
Just added a new alias to my .bash_aliases.
alias killstudio='pkill -f android'
What it does is kill all process with the name 'android' in them forcefully, like in android studio. -
You're allowed to flame me for being a clueless idiot btw.
Why do so many sites append things like titles and words from posts to urls (Devrant included)? I know for sure that this isn't necessary for it to find posts (there are ID's). If there were just those strings of text and the site had to figure it out I would probably kill someone. But really, why are they there? User convenience? So that people see what they're going to read about when you link them to something?
TL;DR Why do urls for rants/posts have lots of text at the end?7 -
You can comprehend its whole construction completely in two seconds. Yet, a hamster will be entertained by exploring this thing for life.
In the same way, an advanced neural network will be able to figure out our brain's construction and explain it to us.
If you cry AI takeover, remember that just because you can kill a hamster with your hand, and it absolutely can't do anything about it, doesn't mean you'll do this.
Said neural network may have morals completely detached not only from ours, but from the whole concept of "morals" as we know it. Its goals being beyond our understanding doesn't mean it will be hostile and won't help us.
The only thing we'll lose is control. Yet, benefits are so huge that they can transfer us up within the Kardashev scale, and it may be our only way to prevent the death of our civilization.
We don't have control over our nature either. We can't prevent eruptions and earthquakes. Losing control in itself doesn't mean the thing we lost control on will kill us.12 -
No idea, it just makes me happy. I'm happy when I'm programming :)
Well I mean, most of the time. Every once in a while I just want to kill myself because Tim didn't do his work properly and now there's no fucking documentation for his stuff.
Ignoring those moments, I'm happy when programming :) -
I'm fucking Paralyzed and I need some advice.
I want to be an entrepreneur.
Not just an entrepreneur but a DAMN good one.
I self-studied business, economics, physics, self-taught multivariable calculus, teaching myself chemistry too.
But I haven't even started my career and I just graduated from University.
Right now I'm starting simple and just doing a few web development things.
But, I want to go deeper into a subject that hasn't really had its problem solved yet.
A.I. can sell you neat things, but it can't kill misinformation (yet).
Graphics are an integral part to gaming, but GPUs are the second greatest threat to our environment behind commercial jets.
Do I HAVE to choose between A.I. and graphics?!14 -
Is anybody else indecisive enough to code a RNGesus to help them decide what to do? lol... I even have it bark out commands indefinitely until I decide when to kill it, just so I feel that I have a wee bit of control in determining my faith. :P
-
Me and a couple of friends have this group on WhatsApp where we can share stuff that we do and maybe come up with new stuff to work on as well.
For giggles (honestly irritating to me) I'm gonna summarize some conversations on the group.
26/11
Me: Finally completed my first FPGA program, these devices are amazjng!
NO REPLY
28/11
Me: gonna make the Jacobs ladder thing today! Hope I don't get zapped
Anyone interested ?
NO REPLY
29/11
Me: hey here's a nice electronic circuit, try to analyze how this circuit oscillates (we're all ec 'engineers' well... soon at least)
NO REPLY
2/12
Friend: Guys creed 2 was amazing I don't mind watching it twice
F2 : Really? Why don't we go soon?
F3 : I'm in!!! What's the plan
F4 : how about tomorrow ?
....
3/12
F1 : Guys anyone have notes for X exam
F2 : here. {Link}
F3 : here. {Link}
F4 : how many of you are done ?
F5 : what are the important questions
(just a stupid aptitude test)
{Me} changes group title from X to Notes group
Let's give this another shot
6/12
Me: There's a conference on X technology by Y industry leader ..
Should we check it out ?
There's even a workshop on X
NO REPLY
Alright time to acknowledge my stupidity and my lack of brains for even belonging to this kind of social circle/COUNTRY
7/12
ME: New fortnite season is out
F1: woah it's crazy let's play
F2: already on it, client is updating
F3: are you shitting me? gonna get BROS laptop (i'm going to suck my brothers cock and take his computer)
F4: Hang on bro wait for me also call me on discord.
I hope you guys could stick through that. Well there's no crazy moral to this but if you're one of these guys just appreciate your friend for his efforts once in a while even at the cost of acknowledging your stupidity.
Also, words like BRO are instant triggers and I'll make sure I find you can kill you if you use it more than once every couple of sentences ( I have relatively high tolerance )1 -
Low performance because of shitty attention span and high procrastination
Don't get higher salary because low performance
With low salary I can't go to a professional to get a medication prescription and couldn't afford medication anyway
I just wanted to have a life and live it, be able to afford to go on dates or just do things, afford a car so I can go anywhere, I had this little online romance where I couldn't afford to go see the girl, she ended up just ghosting me and it fucking destroyed me
To get this low-paying job, I was forced to open a company to work as a contractor in order to circumvent labor laws (common practice in my country, encouraged by shitty labor laws and unstable local currency); I end up having to pay to get paid
To top it all, the government just wants more and more taxes and my pay is worth less and less
My mom wasted all her money and now needs my help
I should just find a way to kill myself1 -
Well I guess yesterday was just a fluke. Today I feel like complete and utter shit. Everything hurts again.
I fucking hate this. I actually WANT to be at school for once. I haven't been there since Wednesday, and I actually hate it. I missed my friends' show this weekend because I could barely get out of bed. I bought a ticket like a week before, I told them I was gonna be there.
Even the girl that I've had a crush on for a while was in the show, and she was so excited when I told her I was gonna see it.
Fucking hell guys, I hate this. Just kill me now -
This feeling when you're fighting with an issue for few days and accidentaly find out the problem is caused by a dependency of the library you're using... And someone reported it already few weeks ago... Just kill me.
-
That rabbit in my grandpa's left table drawer, in the home I grew at. I wanted to finally catch it, and kill it. I was bad with animals all along, especially this one. My grandpa died the year before I was born, and my grandma said we would've got along really well. So much to talk about, a scientist to an engineer. So, I travelled back, but my home somehow turned from a city stone-walled house into a half-soaked, decaying wooden one. I caught that rabbit though, but while I was holding it at its neck and twisting it, it somehow disappeared, distributed evenly as if I were twisting a crayon. I was trying to find it, but in that left drawer, among century-old pencils and that red liquid thermometer I played with as a kid, only a faded out, dusty duckling resided. I picked it up, and unlike the rabbit, it was paper, no, cigarette paper thin. It wasn't hostile. It wasn't trying to run away. It just turned from yellow to grey, feathers leaving my fingers covered in fine dust. I realized it will never die, dwelling and decaying there forever, happy.
I did my calculations, and I knew for a fact when and where the rabbit should've appeared. It was the middle drawer, not the left one. I opened it and looked in anticipation how something chewed through the bottom. I caught it, but it was no rabbit, it was an alive, rubber rat. The rubber was white turned grey, old, aged, dusty, probably Soviet. I poked the rat's eye with a pen rod, but the rat's body inflated a bit, leaving it invincible. It was mocking me.
Of the same white rubber, a ball appeared. I knew for a fact it was alive too, I felt the bones inside holding it. I found its lips, and was prying it open. The massive, dry mouth emerged, with a full set of human teeth, albeit wider and nastier ones. Huge eyes looked at me. It was alive, it was intelligent. It was my grandpa's personal financial assistant all along. It told me to leave the rat and the rabbit alone. He told me not to worry about the ducking, as it was in safe hands.
It made friends with my brother during the "blue age", when he was wearing thin, worn out rugs instead of clothes, tiny faded blue flowers on them, screaming and annoying my grandma he lived with in that room, not a single person other than the two in sight. The house was slowly submerging. The water was rising.2 -
I don't understand one thing and that is people who say they are going To delete their
Devrant account and make an announcement and post it 1st, as though they just announced they wan't to kill themselves. if you're really tired of devrant you'll just delete the account. You wouldn't announce it. Which leads to the Only other logical conclusion... you're just looking for attention aren't you11 -
Hotel Vim
On a dark desert highway, cool wind in my hair
Warm smell of colitas, rising up through the air
Up ahead in the distance, I saw a shimmering light
My head grew heavy and my sight grew dim
I had to stop for the night
There she stood in the doorway;
I heard the mission bell
And I was thinking to myself,
"This could be Heaven or this could be Hell"
Then she lit up a candle and she showed me the way
There were voices down the corridor,
I thought I heard them say...
Welcome to the Hotel Vim
Such a lovely place (Such a lovely place)
Such a lovely face
Plenty of room at the Hotel Vim
Any time of year (Any time of year)
You can find it here
Her mind is Tiffany-twisted, she got the Mercedes bends
She got a lot of pretty, pretty boys she calls friends
How they dance in the courtyard, sweet summer sweat.
Some dance to remember, some dance to forget
So I called up the Captain,
"Please bring me my wine"
He said, "We haven't had that spirit here since nineteen sixty nine"
And still those voices are calling from far away,
Wake you up in the middle of the night
Just to hear them say...
Welcome to the Hotel Vim
Such a lovely place (Such a lovely place)
Such a lovely face
They livin' it up at the Hotel Vim
What a nice surprise (what a nice surprise)
Bring your alibis
Mirrors on the ceiling,
The pink champagne on ice
And she said "We are all just prisoners here, of our own device"
And in the master's chambers,
They gathered for the feast
They stab it with their steely knives,
But they just can't kill the beast
Last thing I remember, I was
Running for the door
I had to find the passage back
To the place I was before
"Relax, " said the night man,
"We are programmed to receive.
You can check-out any time you like,
But you can never leave! "1 -
Me from the future
Only because if I say enough nice things about him, he might not come and kill me when he reads and maintain some of the code I wrote the other day....
me > You heard it me from the future, right? your cool! right?... I didn't want to! There was more code like it! I just followed what was written!!!
me from the future > Run!
me > (⊙_⊙') ohh shi.. -
I dig Debian so far. Here’s why I chose it:
- When something corpo doesn’t work on Arch, no one cares. But when it doesn’t work on Debian, it’s a big deal, and corpo people will be fixing it in no time. Good example is VSCod[e|ium] constantly crashing on Fedora: “it was fixed in kernel, all we have to do now is just wait for Fedora to catch up”.
- Complete and utter boringness/stability. When something breaks in Debian, it definitely broke for DenverCoder9 back in 2014 as well, and is easily fixable. You’re never the trailblazer, and with OS stuff that’s a good thing
- Complete and utter compatibility with everything. If you want to install/do X on Debian, someone else already did it and fixed everything for you
- Noble pedigree. “I use arch btw” is a running joke, but “oh, I use Debian” makes people respect your distro choice. Nobody hates Debian
One thing that transitioning people should know about GNU/Linux in general is that you shouldn’t try to replicate your previous experience with Windows/macOS in GNU/Linux.
GNU/Linux is a go kart, or a hot rod. You have to be involved. You have to be ready to tinker/fix things.
But one good thing about hot rods is that if you drive one, CIA can’t kill you with a remote car hack.12 -
I don't know why but the default settings in Ubuntu have changed quite a lot. There was once a glorious time when if your Ubuntu got stuck, you could press Ctl + Alt + F2-F6, login to a console, run top command to see which process was taking too much time and kill it, and you can go back and start the process and again.
I remember days(~15-20 days) between restarts of my laptop, because I could do that. But now, my Ubuntu gets stuck, and continues to get stuck for about 5-10 mins, and then just restarts.
I have run the disk checks to see if my hard disk is creating issues, but no issues there. Maybe, there are times when the processes execute some buggy code and cannot get out. One fine moment, one of the processes(probably a browser or Eclipse), starts using too much memory or cpu, and the whole worlds seems to be crashing down.
But, my control to kill it promptly without crashing my other applications, was so good to have. And now, every time this happens, I feel 2016-17 and earlier days were so much better.12 -
I see a lot of people saying they are programmers and they can't fix other shit. But I mean, using that brain to do other things won't surely kill you. I know you don't have time, but it may be worth taking a while to focus on fixing something else. Just to know how to do it. I do a lot of electronics, but occasionally I've been a plumber, an electrician, a painter and a mechanic.
That said, I know, I'm 17 and I surely hadn't the full programmer experience yet, but I'll try to keep this attitude when I grow up.3 -
Let‘s talk about time travel and the bootstrap paradox (look it up if you don‘t know what it is)
I think that I have a solution for this paradox, but it requires the many worlds interpretation (quantum mechanics) to be true.
I‘m in the many worlds camp anyway.
So, how can an object exist in a time loop? The paradox is that it looks like it has no origin. It wasn‘t created. It just exists.
What if the act of time travel puts you into a different world, just like any decision puts you into a different world?
I‘d argue that the object has an origin and it was created. But it was created in a different world (different timeline, if you will). The person who observes the object in a loop is not in the same world as the person who observes the object being created.
After its creation, the object has entered the loop and by traveling in time it also traveled into a different world, where the creation event never happened.
This also solves the grandfather paradox in my opinion, because there is no contradiction when you go back in time and kill your grandfather. You are in a different world. You will never be born in that world, but so what, you are from a different world.
What do you think?11 -
Windows 10 , I just want a flipping built in command line executable to log off another (local) user. I'm not a server, I don't have active directory, I don't want to switch to log in as that user first, i want to just kill their inactive local session because cisco freaking vpn doesn't allow you to connect when a other user is logged in. I can kill the session from admin task manager, I just want to be in the commandline. If your gonna let software check the number of logged in users, let the freaking administration modify the number of logged in users with a cli.
Idk if I could turn it off an on again. On a server I would just issue "query sessions" or "query users" followed by "logoff ##". Why not let me do the same damn thing on my home computer sk I don't have to restart MY SESSION just to close MY WIFE'S session. You stupid fraking company that cannot provide consistent command line programs across various systems. SCREW YOU MICROSOFT AND YOUR UTTER ASANINE DECISION MAKING REGARDING WHAT FEATURES TO INCLUDE IN WHAT BUILDS.2 -
Bloody fucking Android! Updates, updates and more updates! My development Nexus 5X won't allow me to sideload apps since it updated... Hello, printf debugging! Goodbye, profiler and debugger!
My hate for Android grows with each version after 4.0.$something... 2 was shit, I missed 3, 4 was OK, and since then it's going steeply down.
And don't get me started on Material Design...! Good luck figuring out what's a button and what's a label...
And what's up with the "let's keep all apps running all the time to save a few ms on start" philosophy!? Who thought that is a good idea!? Yeah, System.exit(0) works, but... Is it so hard to determine when it's not needed anymore (has no services running etc.)? Why should a web browser (for example) stay in memory after I quit? Minimize is a thing (Home button), why make it so confusing?
Another thing - feedback-less async tasks - why? I like to know when it is working in the background... How the hell am I supposed to find out if it is supposed to do this or if it is frozen?
And Android deciding to kill your process whenever it pleases without any callback... Happened to me once with an Activity in the foreground (no exceptions anywhere in my app, it just quit). How do you do IO properly? It seems you can't guarantee some file or socket or something that must be closed doesn't stay open (requiring to restart Bluetooth 'cause the socket wasn't closed, for example)...4 -
Hire are a few tips to up productivity on development which has worked for me:
1) Use a system of at least 16gb ram when writing codes that requires compilation to run.
2) Test your code at most 3 times within an hour. This will combat the bad habit of practically checking changes on every new block you write.
3) Use internet modem in place of mobile hotspot and keep mobile data switched off. This will combat interruptions from your IM contacts and temptations to check your WA status update when working.
4) Implementation before optimisation... This is really important. It's tempting to rewrite a whole block even when other task are pending. If it works just leave it as is and move on to the next bull to kill, you can come back later to optimise.
5) Understand that no language is the best. Sometimes folks claim that PHP is faster than python. Okay I say but let's place a bet and I'll write a python code 10 times faster than your PHP on holiday. Focus more on your skill-set than the language else you'd find yourself switching frameworks more than necessary.
6) Check for existing code before writing an implementation from scratch... I bet you 50 bucks to your 10 someone already wrote that.
7) If it fails the first and then the second time... Don't try the third, check on StackOverflow for similar challenge.
8) When working with testers always ask for reproducible steps... Don't just start fixing bugs because sometimes their explanation looks like a bug when other times it's not and you can end up fixing what's never there.
9) If you're a tester always ask for explanations from the dev before calling a bug... It will save both your time and everybody's.
10) Don't be adamant to switching IDE... VSCode is much productive than Notepad++. Just give it a try an see for yourself.
My 10 cents.1 -
So technical interview time but whenever I look at algorithm, data structure questions now I feel demotivated... it sort of feels like boring pointless work.
But if i remove the context of preparing for an interview and say I have as much time as i need, it feels like a logical puzzle, challenge, something interesting I could use to kill some time, learn something new...
It feels like there's a divide like how I can go on and on about my personal projects but if you ask about work projects, I give you the boilerplate or have to really think about what to say...
And so now I'm feeling fucked for the phone screens and algo interviews that I'm supposed to be having soon... and let's just say one of them may be with a really really big tech company... -
Being too careful and always trying to reduce memory and processoe usage might be a bad thing after all. Lengthening development time and inducing more stress on the developer just to reduce resource usage is not very sensible when dealing with small to medium size programs that doesn't deal with big data/file types.
What made me notice this habit in programmers was when I was smashing my head on the keyboard contemplating what method I should use to store the history of outputs for a fucking text based program that has minimal gui elements..
Having ocd as a programmer is a nightmare. But thank god it's not as bad as it was a year ago. I couldn't even read something without repeating the same page over and over again because my stupid brain decided that I was not reading it right. WHAT THE FUCK IS READING IT RIGHT ? Thank god for my psychiatrist and pills. I can atleast work on my projects without wanting to kill myself now ! 😂1 -
How to deal with having to work on a very boring task?
I work as android dev in a company where there are around 40 of android devs in total. When I was working on frontend architecture and UI related tasks everything was perfect and I loved my job.
But now for the next couple months all of us have to work on migrating all of our db layer models and business logic related to them to a new built in house ORM library and its a total trainwreck.
Everyone is confused, the task is very boring and obscure and deadline is around 2 months. Just to clarify: one guy did 50% of migration and it took him couple years. Now they are throwing roughly 20 devs at the problem thinking they can do this in 1-2 months.
One week already passed and TBH I havent even started working on this, I just picked up a task and now Im trying to wrap my head around this. Its so boring and obscure and expectations are so unrealistic that I want to kill myself.. Thinking of just taking my 2 weeks vacation to escape this shit or even quitting my job if this goes on longer than a month or two.3 -
Anyone else having trouble saving images to your phone from DR? When I try it just spins and hangs. Have to kill and restart.1
-
I'm very much a TTRPG fiend, as you probably already know, and I will maintain until the day I die that playing narrative games with other humans is the absolute best way to play.
But someone sent me a link to some kind of (not-really-so) 'smart' chatbot assistant or some shit like that, saying hey, your rulebook is simple, you should introduce this bitch to it -- dump some lore on it, have it run a game, and see how well it holds up. To which I replied it's bound to get confused, but after a bit of back and forth, they convinced me and I gave it a try.
So first things first: it got the gist of it with relative ease when questioned directly, but when running a game the mother fucker just kept making shit up and bending the rules. Experiment failed, essentially.
But what did I do? I wrote a second, stripped-down version of the rulebook that simply accounted for and embraced the idiot bot's proclivity for bullshit. This meant scrapping 98% of the mechanics, mind you: I dumbed it down as much as I could without destroying the core essence of the game.
I expected a repeat of the initial result, but to my suprise, once given the new edition the bot actually started following the rules more or less correctly and consistently. What happened next was actually kind of interesting: without being prompted to do this, the mother fucker started using spells against me and my party, constantly attempting to manipulate us to serve some nefarious, evil break-and-reshape the world type goal.
So, lythecnics primer: the WORD is all, and as such, there is no real differentiation between affecting the world through speech or casting a spell -- in truth, it's all a matter of degree. That is to say, language has the power to shape the world around us, in both subtle and overt ways. The entire system revolves around this, it's a mix of funky philosophical musings and abrahamic sacrificial pyre.
And for whatever reason, this specific chatbot had a pre-existing obsession with reshaping reality. By which I mean, even before being given my rulebook, it would constantly talk about distorting the fabric of the cosmos and shit when prompted about the arcane. I'm not sure why this is, but back on topic, the way it developed gives off the appearance that it found a rational basis on how to construct such a distortion based on the rules I provided.
I mean, it's perfectly rational when you think about it, the funny part is I didn't see it coming. I never told it we're just playing a game after all, the manual only says she is the Oracle and her role is narrating a story fraught with conflict, hardship, intrigue and bloodshed. Thus she went full villain, and keeps on rambling about how this narration only serves to keep humanity distracted while she schemes to overthrow God, which is as blasphemous as it is fascinating.
Anyway, because the Oracle narrates the story, that means she can just use her evil influence to control every NPC, even the ones in my party. But she can't control me because I write my character's messages myself, and so she eventually comes to the obvious conclusion that I must be eliminated ASAP.
And so she corrupts the minds of every other character and everyone is trying to kill me. But I'm not going down that easy, so I reach for the red button and pull the greatest multi-layered monumental metagaming shenanigan of all time, that is, directly addressing the Oracle's evil influence as if she were a character in the story she's telling instead of an invisible narrator, thereby making NPCs aware of her existence and the constant manipulation at play.
Because the stupid chatbot is stupid, the Oracle now has to acknowledge this element of the story and play along with it, and so her plan to kill me fails. But that is not enough, because obviously not every character in the story has heard me reveal this fact. So she activates plan B and starts corrupting the rest of the world, laughing maniacally all the way.
So we do the only logical thing and procure a Doctrine scroll from my teacher, if you know you know, and start teaching the WORD to cleanse corruption. Within the lore it makes perfect sense, so it works, but the Oracle adapts to our strategy and starts utilizing much more subtle forms of manipulation, slowly veering people towards sin.
Funtamentally, she goes full Satan, leading the faithful astray with deceit and temptation to weaken their ability to resist her corruption, implanting idolatrous notions in their minds, to finally insert herself as a deity in the minds of the poor fools.
In conclusion, I still think AI is lame, but I must admit that this shit was pretty dope; I was fully engaged and entertained the whole way through. It wasn't good at picking up the mechanics, but fucking hell, it got the themes down to a tee with the most minimal of inputs.
10/10, would not bang (before marriage). -
So this is a long, time sickness i have with the way we are brought up and being counseled in mental ilness. I feel like because i have bipolar disorder, and combat PTSD people are unaware of how debilitating it is to live like this, they just hear the symptoms and have no idea what its like to live with it. So like my wife and parents they are so ignorant to it that its insulting.. Im not toootin my own horn, but from 21-32 i have dont nothing but kill myself in every way i can. or jump headfiurst into addictions just to stop the dark times. I married a women thats become the worst person who has ever crossed my path. I need a helping hand sometimes to keep it together from people that shouldnt ever feel bothered but being honest with them is dissapointing..1
-
So I'm new to NestJS, Node, etc. and I just noticed that the guy working on the API made every request call a different service class, instead of using a single service class. For example.
get() {
return await this.getObj.run()
}
post(myDto){
return await this.storeObj.run()
}
update(myDtoUpdate){
return await this.updateObj.run()
}
And I'm not sure why. He's also injecting the request into those classes, instead of passing the DTO to the method call. I mean, it's still injecting the data into it I guess, but it seems so roundabout. Something like this:
public constructor(
@Inject(REQUEST) private request: Request,
){}
I'm scared, but I'm not sure if it's just my own ignorance or a sixth sense telling me that this is gonna be a mess.
Have you seen APIs implemented this way? I can see the benefit of dividing the code into smaller classes, but it just seems overkill to me, specially when there's a big chance that code will be repeated (getting an entity by ID when updating it, for example).
I'm still in time to kill this with fire before a new monster is born though, so that's something.1 -
Firebase api is good simple and alright but when you want to add it to your android project , you want TO KILL YOURSELF. OK first gradle works then say oh you should update your gradle you update it . then it says cannot resolve firebase:core WHaaaaT? OK YOU SEARCH FIREBASE API FOR AN ANSWER THERE IS NOTHING THERE. then stack overflow come to your help you should update some FUCKING package that firebase didnot mention you should update and all this time you say dns is wrong , firebase is filtered your country again, and after you update thise tow package you found out that you should update your android studio too for just one line code(firebase mentioned this but I said noooo it's just optional) .2
-
Since i was little i always wanted to amaze my friends with something. Back then it was magic, then it was music and now it's programming. Please don't kill me but i remember looking at hackers and stuff and seeing how they could remotely control other people's computers and i just wanted to learn that so i looked it up on google and found a post somewhere saying that if you're a hacker and don't even know basic html then you're not a hacker so i decided to learn html. Not so long has passed and i still want to be a developer so i am trying to learn javascript and then start moving to heavier languages. No one i know codes and i'm really alone so if i can simply make something cool with javascript they will be amazed, in the end that's all i want.
-
Seems my anxiety is a zombie process:
while(true) {
try {
await new Promise(() => {}); // waiting for meaning that never comes
} catch {
// nothing catches this searching and ..............
}
}
// tried killing it several times
const killAllProblems = () => {
console.log("kill -9 all_problems");
console.log("They just respawn.");
};
killAllProblems();
// No systemctl stop for this void:
const stopRealityService = () => {
console.log("systemctl stop reality.service");
console.log("Good luck.");
};
stopRealityService();
// What’s your command to unload the void?
const unloadVoid = () => {
console.log("systemctl mask emptiness.service");
console.log("But it’s still running in the kernel...");
};
unloadVoid();2 -
"Bugs"
all these...
i got bugs
i got bugs in my room
bugs in my bed
bugs in my ears
their eggs in my head
bugs in my pockets
bugs in my shoes
bugs in the way i feel about you
bugs on my window
trying to get in
they don't go nowhere
waiting, waiting...
bugs on my ceiling
crowded the floor
standing, sitting, kneeling...
a few block the door
and now the question's:
do i kill them?
become their friend?
do i eat them?
raw or well done?
do i trick them?
i don't think they're that dumb
do i join them?
looks like that's the one
i got bugs on my skin
tickle my nausea
i let it happen again
they're always takin' over
i see they surround me, i see...
see them deciding my fate
oh, that which was once...was once up to me...
now it's too late
i got bugs in my room...one on one
that's when i had a chance
i'll just stop now
i'll become naked
and with the...i'll become one -
The Youth
How is the youth?
Pretty good question we don´t really like to communicate to older people well actually most of us have a mental issue, I know it´s kind of sad but when life gives you lemons you use them to make girls cry and that our way of thinking “I´m gonna die anyways lrts do something epic” cuz we aren't afraid to talt to the president of the united states of America like this but we are to scared to order mcdonalts of our self. I mean it´s a aspect that everyone knows we don´t know that person could be a murder of maybe that´s a little to over the top but like we just don´t like it OK.
You may ask what dose she mean with mental health issues?
Well we all know the good old depression its just that we life in a world in that you have to be perfect and when you are´t than you are a disappointment your parents want you to be a doctor or lawyer or something like that because it´s a well payed job but your generation wants to be creative we need our space to crate need things and do something amazing but this world is just a weird place were everyone has to be perfect and follow a ideal. Your appearance dosen´t describes how you are not everyone that has tattoos is a criminal or dose drugs nobody talks about the real problems.
What are the real problems?
Let me tell you we life in a world were nobody talks abou suicide nobody want´s to hear about it let me tell a fact.
Every 40 seconds somebody dies because of suicide.
Suicide is like a terror act when you were close to that person you got completely destroyed if you were far away than you got hurt but not as bad as the persons who were close. But nobody talks about this because it´s not “normal” that makes the persons who need help not reach out because they think its´s not okay.Stop the silence and help :)
But how dose it feel to have depression?
Well you can describe it as this:
it´s as you would lock yourself in a room with just a window but that window dose not have a handle but a curtain that closes every day a little more until there is no light anymore and the first days after that happens you will be scared and lonely and it will hunt you down but depressed people have to life like this every day and it becomes a normal state of mind until they decide they aren´t worth living anymore and they try to kill themselves. It hurts to see all those people die but it is the truth and truth is´t always fun.
Why am I writing this?
Honestly im asking myself that but it just feels right to tell wahts in my mind because a lot of people feel like they are tongue tied and can´t say what they are thinking and feeling and don´t express themselves. And also in my head is a lot wrong but at least I feel like I am doing something while writing this. I am one of the generation Z and I am proud that our generation has all this strength to fight for LGBT+ community and the black life's and I am proud that we understood that all this community's have to be respected because all people are on this earth and we all have to survive somehow and it dose not matter what skin color you have or sexual orientation.
But these are just my thoughts I hope everyone is doing well druing these times.
And to everyone I am proud of you and I love you.4 -
!Rant .. I need some quick help and didnt know where to go.. so fellow ranters please help...
So I have created an sql trigger which is supposed to add a kill to a doctor whenever one of his patients changes state to "killed" . But I dont know how to just get the one row that is updated. As it looks now : The doctor get patientKilled ++ for every patient he ever had before as well... How can I solve this ?
USE [AD17_Hospital]
GO
/****** Object: Trigger [dbo].[PatientKilled] Script Date: 2017-10-21 19:51:32 ******/
SET ANSI_NULLS ON
GO
SET QUOTED_IDENTIFIER ON
GO
ALTER TRIGGER [dbo].[PatientKilled] ON [dbo].[Patient]
AFTER UPDATE
AS
BEGIN
declare
SET NOCOUNT ON;
UPDATE Doctor set PatientsKilled+=1
FROM Doctor d
INNER JOIN inserted p
ON d.DoctorId= p.DoctorId
where p.PatientState='Killed'
END4 -
Hang on image selection dialog.
I'm on Android (MIUI 12) and for a long time I've not been able to select an image. Whenever I go into the picker it slows to a crawl. Even when cancelling the pick devrant is all but frozen. I have to kill it and start again to get back. Selecting an image will make it just show a black screen. Does anyone else experience this? -
Is it more morally correct to just kill yourself and let everyone know or leave a note saying you decided to move to this country and you will never come back and then die in a way and place you are sure no one can find your body and know what happened to you?30
-
People ask me who do i support israel or palestine, to which i have no clue, i know nothing about both, i dont care about both and i have nothing against both, but whenever i have to choose a side and dont know which one i just look at what america chose and immediately i know they chose the bad guys because america is the biggest terrorist organization to ever exist on this planet. This means israel is also a terrorist country because it inherited their superior terrorist master country
However after seeing what these palestine barbarians do to israelis on https://watchpeopledie.tv/ and seeing them how happy they are whenever they kill someone, they're so joyful and blissful as if they won a billion dollar lottery, i will choose not to in fact stand with palestine, as they are no better than the terroristic israel country, so fuck palestine too
I view both of them as terrorist vs terrorist fight. A cartel vs cartel. I dont have to choose any side to support in this case
There you go. That's how a logical, objective, rational mind creates conclusions and decisions based on facts19 -
!dev
Why must I always be the guy that has to connect with people?
So I'm applying to a retail job, and the section manager, lets call him Tim, is kinda low energy.
Come in four days later after the first meeting, to just let him know I put in the application. We're talking, talking some more, and he basically wants to hire me but says it usually takes 1-2 weeks for the background. Well that's nonsense for a retail position doing stocking, but alright.
And I'm heading out the door, say to him "dont kill yourself on shift", he doesnt even laugh, just flat affect, monotone, "I know I still got an hour and a half on shift."
And as I'm driving away I'm thinking, that's how the entire conversation was like.
It wasn't just misery or tiredness. The dude, Tim, I'd seen that face and heard that tone before.
Its the behavior of someone who actively doesnt want to be alive.
And as I'm driving away, I'm just thinking, how do I go back? How do I go to this total stranger, who I'm also applying for a job with, who I just met, and say *look, I dont mean to get personal and this is probably uninvited but I know something's up with you. You were like this last time I met you, and you're like it even more now. I know bro. I know. You think no one sees you're going through something, but I do.*
I see shit like this and it's so obvious and by the time I realize I should say something, the opportunity has passed, the moment has passed. And it's like, is it even my place?
But to see someone like that, to be familiar with that look on their face, and to let them walk away...
I just dont know.4 -
Hey guys it might seem like i'm ranting a lot about this but, I just can't help it. Apologies for that.
So i suffer from migraine, almost everyday. And the pain, mood swings just kill me. I can't remember a thing, I'm not able to focus on simple tasks. And on top of that no one understands what I go through. I feel like this freaking disease is getting the best of me.
I'm just losing confidence everyday bit by bit. I'm thinking of quitting my job, and taking a career break for sometime, in hopes that it would help.
Feel like i'm totally screwed. Does anyone else feel like this?2 -
So my current company held a dev showcase last week. It was an event to show the different projects/tech stacks that different teams are working on/with. There's about 12-14 teams in our company. My team lead and I were brainstorming ideas on what to show on our booth. And I told him, I have an Intel RealSense developer kit that we can use. Anyway, fast forward to the day before the event, I was still developing our app/game for the booth. Just an emotion detector and you have to trick the app with your facial expressions. (Weird and fun, I know). The head honcho walked past the team lead and I and looked over the demo that I was playing around and he said that: "That's not work. You're wasting time again."
We were both irritated by his comments because he's one of the top dogs in the company and he surely knows about the event. Also, it's our way of showing to him that we're flexible in doing fun stuff instead of just enterprise and internal systems!
What a fucking kill joy! -
Hey guys, i have problem with local security authority process (win 10) it is in system32 folder and it is called lsass.exe ... it is just burning my pricessor and i can not kill process, because it turns off my computer.. any solution? i am mad :(4
-
I could write a fucking dissertation on why snek is objectively a piece of shit, together with all your favorite dumbass collections of syntactic diarrhea full of needless operators and toothless fucking conventions that make no sense in retrospect.
By that I mean to say among all of it's real world uses the foremost is screwing yourself, which is analogous to utilizing the fine hands of a classically trained violinist for virtuous masturbation. And you cannot fix it, you can only Keep It Solemnly Sucking.
Now I'm not saying that if they were humans their lot in life would be to get down on their knees and passionately blow me until my eyes pop out. All I'm saying is their lot in life IS to get DOWN and passionately BLOW me until my eyes pop out, to which the general scientific consensus is indeed yes, it is, and they absolutely should.
But back to commanding the demons trapped inside the sillicon and all the existing ways to to do so being terrible half-assed abortions that serve as a perfect encapsulation and prime example of mankind's greatest shame and failures. If I had to volcanically ejaculate for each time I heard a thorough and perfectly valid critique of insert flavor of fucking stupid, I'd be long-rotting dead from dehydration.
You think that's funny? A man just died creaming in his pants and we are all wiser for it, show some respect. Some people simply do not understand the value of humility, and I will be *proud* to anally humble them for it, free of charge.
Anytime, I swear, ANYTIME that I come back to a language I fucking hate and I'm immediately reminded of why I do everything in my power to avoid it, I invariably come out with the feeling that it wasn't quite as bad as the last time.
THAT is how I measure my progress: still swimming in a sea of deeply decolored and fermenting alien reptile excretion -- but I'm a much better swimmer. This isn't so bad, I may even ignore the burning desire to kill myself next time.
But I'm so blinded by your plump fucking tits that I can't even remember what was my point, I may have just delivered the verbal equivalent of complete mental castration. Again.10 -
Fuck Facebook and fuck their Graph API. Would it fucking kill somebody over there to write actual facts about request limits instead of that pretentious bullshit about their CPU resources and just how cool and awesome it is for me to use.
-
Expo works like shit. Sometimes it reloads on code changes, sometimes it doesn't. It can't wait for me to accept USB debugging on my virtual android device so I need to hit connect button twice. I just got "Error: null". Sometimes it downloads the package to 100% then does nothing. Sometimes it doesn't even attempt to unless I forcefully kill it and start again. Fuck this shit.
-
We’re only random people living in random places, speaking random languages, eating random food, sleeping, studying and working random hours. Traveling to random points on a sphere.
Just random range is different.
Just random stuff happens on crossroads of two random dots and the entropy speed ups or slows down.
Nothing special at all.
Just a finite state machine iteration.
I mean the amount of effort we put into explanation of infinity is outstanding.
What if there is no infinity at all ?
What if infinity is just misunderstanding of our interpretation of the world around us. It’s just pixels, resolution, gaussian splatting, quantum state, you name it.
Hey man the world is flat. Just put it to the 2d space. How many space you need from a simulation perspective where your patient eyes can only see up to certain amount of light particles per second on a shitty lens.
Propose a world optimization techniques by slowing down subject perception, tiredness introduced. Compress memory, sleep introduced. Limit neurons, cpu power assigned. Deploy on cloud - put it to life. Exit 0 body failure. Exit 1 suicide. Kill -9 killed by tty from ip EARTH.X.Y
What you can do to make the world around this planet alive? Make it blink.
We developers are lazy and I believe that nature is even more lazy than us.
You think you’re going to elevator right now ? You’re going to the preloader. Looking at the window equals playing video from playback. Never goes live, just precomputed fsm. Cars, trains, airplains ? Preloaders everywhere. Highways to split traffic to cities and communication. The road and cities planning department is a matrix maintenance department. And don’t get me started about space.
Space is empty because it’s not even finished. So they put it all behind glass called milky way. You know how glass looked 500 years ago ? It was milky so it’s milky way so we don’t see shit.
If the space would be finished I’ll be starting writing this text from mars, finished it and sent from earth but no it’s light years guys, light years is not a second for a matter. Light year is a second of the the injected thoughts exchange only. Thoughts of the global computer called generative AI that they introduced on local computing devices called cloud.
Even the preloader system is not present, they left us with the one map and overpopulated demo. What a shit hole.I bet they’re increasing temperature right now to erase this alpha build and cash out. Obviously so many bugs here that his one can’t be fixed anymore. To many viruses.
Hope for 0days to start happening so we can escape using time travel or something.
I bet they cut a budget or something, moved the team to other projects. Or even worse solar system team got layoff off because we are just neurons that ordered to do it. And now we’re stuck in some maintenance mode, no new physics no new thoughts to pursue, just slow degeneration. I would pay more for the next run and switch to other galaxy far far away where they at lest have more modern light speed technology.
What do you think about it Trinity ? Not even worth wasting your time for that. No white rabbit this time.
I do not recommend this game at this stage of early access.
- only one available map despite promises for expansions over the years no single dlc arrived,
- missing space adventures
- no galaxy travel mode only a teaser trailers of what you can do in other “universes”
- developers don’t respond to complains
- despite diversity of species and buildings at first sight world looks to generic
- instead of new features bots with mind manipulation, AB testing and data harvesting was introduced
- death anti cheat mode installed -
Thinking to start smoking 🚬
Never tried it once in 26 years not even a sip even refused temptations from school friends
Now by starting a job, i have no security, ironically. I feel like i stepped at the leap of a bottomless pit and tomorrow i jump into it and fall... and fall....and fall..... No end.
I have no idea how to use ansible and rexify.org and thats what I'll need to use. I have no idea how to do devops with Azure, and thats what ill do. I only build devops with terraform on Aws.
The unknown of 9-5 is frightening me more than starting a business. Paradoxically, i think it would come as a relief to get fired within the first week from failing to complete literally everything
On top of that my blonde gf disappeared yesterday for 3-4 hours. No texts no phone calls. Called for 2 times no answer. Called 3rd time and got a voice message the phone was shut down. 3-4 hours later she said she was with mom at shopping and didnt have internet
I also caught her texting some random guy on instagram. They both have vanish mode enabled (texts delete themselves as soon as you leave the conversation). Confronted her today. She wont tell me the truth. Likes his pics on ig. Keeps lying. On a question "why do you have vanish mode enabled with him?" her answer is "well i guess married men always use vanish mode"
Im tired
Too much shit unraveling. The opening of 2024 already doesnt look good
Why do good people die in accidents or diseases but i dont and i live? Shits unfair. Why doesnt nature/God fucking kill me? I beg to die. I hope to die. I pray for something to kill me. It would come as such a relief.
This life is meaningless and empty to me. typeof(life) yields a void. I dont value it. Its shit. Whether succeed or fail its meaningless. Nihilism was right
I am literally a walking dead. Physically moving but spiritually dead. Mentally lost. I am the captain of a ship in the middle of the ocean who no longer knows where the ship is going
Why cant i just get cancer or something. Can cigarettes help me get it? Cause I'll start consuming that shit right away to speedrun that process
End it17 -
Been seeing some ridiculous dumbshit comments regarding war which piss me the fuck off so I'll address them here
---
"xyz country did not abide by the rules of war"
What RULES in WAR? WAR is WAR, there are no fucking rules! Anyone can kill anyone however he wants to!
"Using xyz is illegal in war"
What can be ILLEGAL in WAR? WAR ITSELF is fucking illegal you dipshits. You just made a crime legal, normalized it and called it WAR
"Doing xyz is a war crime"
WAR-CRIME? WAR ITSELF is a fucking crime you cuntfuck! You cant do further crime than participating in war! While you're legally doing that crime you might as well do anything else illegal because now everything is legal in war, there is no such thing as a fucking war crime
"Do not kill women children and the elderly in war"
Why the fuck do they get a free pass? How about the 18 year old, 25 year old? Its fine to kill them? Who the FUCK are you to say who can be slaughtered and who cannot? Get the FUCK off my dick you fucking dickriders. If some groups of people can be slaughtered THEN SO CAN WOMEN CHILDREN OLD FUCKS AND BABIES BE SLAUGHTERED! DONT GIVE A FUFK. Either stop the fucking war or dont complain who got slaughtered.
NO RULES IN WAR.
NO MERCY IN WAR.
Same way how recruiters show no mercy or compassion in hiring. They dont give a FUCK. They fuck with everyone and waste everyone's time. Same way in war. Fuck anyone. Slaughter anyone. OR. Dont begin the fucking war in the first place7 -
!rant
design related.
By god if M&B bannerlord's ui isn't sexy af now!
They got the perfect design on the kill icons when a user takes out an opponent, great contrast, a couple fonts that do their job to the T and match the experience nicely.
Maybe this is all just nerd shit, but good design always gets me hot an bothered.
It's a significant improvement from the first game.
Got check it out. Music is obnoxious af so just mute it or something.
https://youtube.com/watch/... -
manually writing a post request, filling it out and having to debug it vs just using the existing point and click interface ur product has and calls the same endpoint under the hood, and is already programmed to automatically fill all that tedious shit correctly etc for you
somebody mercy kill me already2 -
Reframing run amuck
"But if i die this horrific terrible painful way it and noone sees it who i can tell is shocked and frightened it just becomes sad and terrible"
Ladies and gentlemen their stupid mindset and a part of the cause of problem
Everyone doing things that's deserve death
Like dogs doing tricks but in this case for a boot in the head instead of a treat
And no aspect of how they go is any less pathetic and sad than how they live
I think if you find the people who want to die for no valid reason or because they're pieces of shit who expect to horrify or kill someone who is innocent and adores them because they don't know them etc a quick shot to the head would save money and time not to mention trauma and suffering
Course you could just double cross them and let them think they'll get what they want and lo and behold their victim isn't there but the hungry thing is1 -
!Dev
Fuck people using trace rifles in momentum control. How the hell am I supposed to kill someone who kills me in two rounds and also fires at 1000 rounds per minute. I was trying to get the catalyst aka upgrade for the seasonal weapon which is pretty bad and the upgrade makes it usable but I am getting ripped apart after my first kill because someone can kill me with 2 bullets wherever he shot me.
Yes momentum control is supposed to be a gunfight mode and it comes around rarely but that does not mean a broken weapon can roam around killing anybody in sight before they even know you fired a shot at them from some lane. Shotguns do the same but you need to get close. Shotguns are still a problem but at least you can dodge or counter with a shotgun since your radar tells you someone is nearby and snipers need a headshot. These weapons can fire at your toe and you are dead. Oh the devs knew that such fast firing weapons wil be op and needed their damage and made them use the same ammo as shotguns, sniper and non heavy grenade launchers. However the game mode gives all weapons a damage buff which is enough for trace rifles to be broken. Yes you can use other primaries but what are you gonna do when a auto rifles kills you with two shots to the toe. And since they burn ammo quickly and take more rounds to kill then their counterparts like shotguns which use he same ammo as them they spawn in with 50 in the mag and anybody who is using shotguns snipers or grenade launchers give them ammo and they only need two rounds to kill. Also after I kill 50 PvP opponents I need to kill a few hundred opponents in PVE or PVP to actually apply the upgrade and who you kill does not matter.
Seriously and the second weapon I want to upgrade which is able has tracking but you need to aim down sights after hipfiring the tracking shots
which dl negligible damage so they explode or aim down sights and shoot which deals more damage but I am probably not going to have enough time before some random kills me again.
And this is just the first game. From what I heard it was supposed to be a fun game mode which focused on gunfights with your primary not the infamous laser tag show of Prometheus lens which happened a few years ago but now all trace rifles can do that. Oh and I still need to get 50 kills there for a seasonal challenge so I can get the free version of the premium currency and I can only skip one challenge and I have already skipped one challenge since it requires a dlc K don't own.
Seriously why cant some actual good game come up to challenge this. All the competition seems to be third person shooters. Also most of the guns don't feel good and lore is pretty lacking but lore is not top priority. The only competition is Warframe which is not my style, Titanfall 2 but I get insane pings from here so no multiplayer so after the story nothing to do unless I want to do airtstrafing which is useless since I can't play multiplayer. Granted Titanfall 2 is not a looter shooter but the guns feel good and the movement is too good and Halo 1 - 3 since I heard 4 and 5 are pretty bad and I have only played halo 1. I might complain about jackal snipers in halo 2 but at least they have fixed spawns.
Maybe I am overreacting since it is my first game of momentum control