Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "well why did you not"
-
Interviewer: Welcome, Mr X. Thanks for dropping by. We like to keep our interviews informal. And even though I have all the power here, and you are nothing but a cretin, let’s pretend we are going to have fun here.
Mr X: Sure, man, whatever.
I: Let’s start with the technical stuff, shall we? Do you know what a linked list is?
X: (Tells what it is).
I: Great. Can you tell me where linked lists are used?
X:: Sure. In interview questions.
I: What?
X: The only time linked lists come up is in interview questions.
I:: That’s not true. They have lots of real world applications. Like, like…. (fumbles)
X:: Like to implement memory allocation in operating systems. But you don’t sell operating systems, do you?
I:: Well… moving on. Do you know what the Big O notation is?
X: Sure. It’s another thing used only in interviews.
I: What?! Not true at all. What if you want to sort a billion records a minute, like Google has to?
X: But you are not Google, are you? You are hiring me to work with 5 year old PHP code, and most of the tasks will be hacking HTML/CSS. Why don’t you ask me something I will actually be doing?
I: (Getting a bit frustrated) Fine. How would you do FooBar in version X of PHP?
X: I would, er, Google that.
I: And how do you call library ABC in PHP?
X: Google?
I: (shocked) OMG. You mean you don’t remember all the 97 million PHP functions, and have to actually Google stuff? What if the Internet goes down?
X: Does it? We’re in the 1st world, aren’t we?
I: Tut, tut. Kids these days. Anyway,looking at your resume, we need at least 7 years of ReactJS. You don’t have that.
X: That’s great, because React came out last year.
I: Excuses, excuses. Let’s ask some lateral thinking questions. How would you go about finding how many piano tuners there are in San Francisco?
X: 37.
I: What?!
X: 37. I googled before coming here. Also Googled other puzzle questions. You can fit 7,895,345 balls in a Boeing 747. Manholes covers are round because that is the shape that won’t fall in. You ask the guard what the other guard would say. You then take the fox across the bridge first, and eat the chicken. As for how to move Mount Fuji, you tell it a sad story.
I: Ooooooooookkkkkaaaayyyyyyy. Right, tell me a bit about yourself.
X: Everything is there in the resume.
I: I mean other than that. What sort of a person are you? What are your hobbies?
X: Japanese culture.
I: Interesting. What specifically?
X: Hentai.
I: What’s hentai?
X: It’s an televised art form.
I: Ok. Now, can you give me an example of a time when you were really challenged?
X: Well, just the other day, a few pennies from my pocket fell behind the sofa. Took me an hour to take them out. Boy was it challenging.
I: I meant technical challenge.
X: I once spent 10 hours installing Windows 10 on a Mac.
I: Why did you do that?
X: I had nothing better to do.
I: Why did you decide to apply to us?
X: The voices in my head told me.
I: What?
X: You advertised a job, so I applied.
I: And why do you want to change your job?
X: Money, baby!
I: (shocked)
X: I mean, I am looking for more lateral changes in a fast moving cloud connected social media agile web 2.0 company.
I: Great. That’s the answer we were looking for. What do you feel about constant overtime?
X: I don’t know. What do you feel about overtime pay?
I: What is your biggest weakness?
X: Kryptonite. Also, ice cream.
I: What are your salary expectations?
X: A million dollars a year, three months paid vacation on the beach, stock options, the lot. Failing that, whatever you have.
I: Great. Any questions for me?
X: No.
I: No? You are supposed to ask me a question, to impress me with your knowledge. I’ll ask you one. Where do you see yourself in 5 years?
X: Doing your job, minus the stupid questions.
I: Get out. Don’t call us, we’ll call you.
All Credit to:
http://pythonforengineers.com/the-p...89 -
Yesterday: Senior dev messages out a screenshot of someone using an extension method I wrote (he didn’t know I wrote it)..
SeniorDev: “OMG…that has to be the stupidest thing I ever saw.”
Me: “Stupid? Why?”
SeniorDev: “Why are they having to check the value from the database to see if it’s DBNull and if it is, return null. The database value is already null. So stupid.”
Me: “DBNull is not null, it has a value. When you call the .ToString, it returns an empty string.”
SeniorDev: ”No it doesn’t, it returns null.”
<oh no he didn’t….the smack down begins>
Me: “Really? Are you sure?”
SeniorDev: “Yes! And if the developer bothered to write any unit tests, he would have known.”
Me: “Unit tests? Why do you assume there aren’t any unit tests? Did you look?”
<at this moment, couple other devs take off their head phones and turn around>
SeniorDev:”Well…uh…I just assumed there aren’t because this is an obvious use case. If there was a test, it would have failed.”
Me: “Well, let’s take a look..”
<open up the test project…navigate to the specific use case>
Me: “Yep, there it is. DBNull.Value.ToString does not return a Null value.”
SeniorDev: “Huh? Must be a new feature of C#. Anyway, if the developers wrote their code correctly, they wouldn’t have to use those extension methods. It’s a mess.”
<trying really hard not drop the F-Bomb or two>
Me: “Couple of years ago the DBAs changed the data access standard so any nullable values would always default to null. So no empty strings, zeros, negative values to indicate a non-value. Downside was now the developers couldn’t assume the value returned the expected data type. What they ended up writing was a lot of code to check the value if it was DBNull. Lots of variations of ‘if …’ , ternary operators, some creative lamda expressions, which led to unexpected behavior in the user interface. Developers blamed the DBAs, DBAs blamed the developers. Remember, Tom and DBA-Sam almost got into a fist fight over it.”
SeniorDev: “Oh…yea…but that’s a management problem, not a programming problem.”
Me: “Probably, but since the developers starting using the extension methods, bug tickets related to mis-matched data has nearly disappeared. When was the last time you saw DBA-Sam complain about the developers?”
SeniorDev: “I guess not for a while, but it’s still no excuse.”
Me: “Excuse? Excuse for what?”
<couple of awkward seconds of silence>
SeniorDev: “Hey, did you guys see the video of the guy punching the kangaroo? It’s hilarious…here, check this out.. ”
Pin shoulders the mat…1 2 3….I win.6 -
Sit down before you read this.
So I interviewed a guy for a "Support Engineer" internship position.
Me and the team lead sit down and are waiting for him to enter, but apparently he's actually making a coffee in the kitchen.
This isn't exactly a strike since the receptionist told him that he can go get a drink, and we did too. It's just always expected for him to get a glass of water, not waste 3 minutes brewing a coffee.
In any case he comes in, puts the coffee on the table, then his phone, then his wallet, then his keys and then sits on our side of the table.
I ask him to sit in front of us so we can see him. He takes a minute to pack and tranfer himself to the other side of the table. He again places all of the objects on the table.
We begin, team lead tells him about the company. Then I ask him whether he got any questions regarding the job, the team or the company . For the next 15 minutes he bombards us with mostly irrelevant and sometimes inappropriate questions, like:
0: Can I choose my own nickname when getting an email address?
1: Does the entire department get same salaries?
2: Are there yoga classes on Sundays only or every morning?
3: Will I get a car?
4: Does the firm support workspace equality? How many chicks are in the team?
5: I want the newest grey Mac.
And then.. Then the questions turn into demands:
6: I need a high salary (asks for 2.5 more than the job pays. Which is still a lot).
I ask him why would he get that at his first job in the industry (remind you, this is an internship and we are a relatively high paying company).
He says he's getting paid more at his current job.
His CV lists no current job and only indicates that he just finished studying.
He says that he's working at his parent's business...
Next he says that he is very talented and has to be promoted very quickly and that we need to teach him a lot and finance his courses.
At this point me and the team lead were barely holding our laughs.
The team lead asks him about his English (English is not our native language).
He replies "It's good, trust me".
Team lead invites him for an English conversation. Team lead acts like a customer with a broken internet and the guy is there to troubleshoot. (btw that's not job related, just a simple scenario)
TL: "Hello, my name is Andrew, I'm calli..."
Guy: *interrupts* "Yes, yes, hi! Hi! What do you want?"
TL: "Well, if you let me fi..."
Guy: "Ok! Talk!"
TL: "...inish... My internet is not working."
Guy: "Ok, *mimics tuning a V engine or cooking a soup* I fixed! *points at TL* now you say 'yes you fixed'".
Important to note that his English was horrible. Disregarding the accent he just genuinely does not know the language well.
Then he continiues with "See? Good English. Told you no need to check!".
After about half a minute of choking on out silent laughter I ask him how much Python experience he has (job lists a requirement of at least 1 year).
He replies "I'm very good at object oriented functional programming".
I ask again "But what is your experience? Did you ever take any courses? Do you have a git repository to show? Any side.."
*he interrupts again* "I only use Matlab!".
Team lead stands up and proceeds to shake his hand while saying "we will get back to you".
At last the guy says with a stupid smile on his face "You better hire me! Call me back tomorrow." Leaves TL hanging and walks away after packing his stuff into the pockets.
I was so shocked that I wasn't even angry.
We both laughed for the rest of the day though. It was probably the weirdest interview I took part at.35 -
The first time I realized I wasn't as good as I thought I was when I met the smartest dev I've ever known (to this day).
I was hired to manage his team but was just immediately floored by the sheer knowledge and skills this guy displayed.
I started to wonder why they hired outside of the team instead of promoting him when I found that he just didn't mesh well with others.
He was very blunt about everything he says. Especially when it comes to code reviews. Man, he did /not/ mince words. And, of course, everyone took this as him just being an asshole.
But being an expert asshole myself, I could tell he wasn't really trying to be one and he was just quirky. He was really good and I really liked hanging out with him. I learned A LOT of things.
Can you imagine coming into a lead position, with years of experience in the role backing your confidence and then be told that your code is bad and then, systematically, very precisely, and very clearly be told why? That shit is humbling.
But it was the good kind of humbling, you know? I really liked that I had someone who could actually teach me new things.
So we hung out a lot and later on I got to meet his daughter and wife who told me that he had slight autism which is why he talked the way he did. He simply doesn't know how to talk any other way.
I explained it to the rest of the team (after getting permission) and once they understood that they started to take his criticism more seriously. He also started to learn to be less harsh with his words.
We developed some really nice friendships and our team was becoming a little family.
Year and a half later I had to leave the company for personal reasons. But before I did I convinced our boss to get him to replace me. The team was behind him now and he easily handled it like a pro.
That was 5 years ago. I moved out of the city, moved back, and got a job at another company.
Four months ago, he called me up and said he had three reasons for us to meet up.
1. He was making me god father of his new baby boy
2. That they created a new position for him at the company; VP of Engineering
and
3. He wanted to hang out
So we did and turns out he had a 4th reason; He had a nice job offer for me.
I'm telling this story now because I wanted to remind everyone of the lesson that every mainstream anime tells us:
Never underestimate the power of friendship.21 -
Hi, I am a Javascript apprentice. Can you help me with my project?
- Sure! What do you need?
Oh, it’s very simple, I just want to make a static webpage that shows a clock with the real time.
- Wait, why static? Why not dynamic?
I don’t know, I guess it’ll be easier.
- Well, maybe, but that’s boring, and if that’s boring you are not going to put in time, and if you’re not going to put in time, it’s going to be harder; so it’s better to start with something harder in order to make it easier.
You know that doesn’t make sense right?
- When you learn Javascript you’ll get it.
Okay, so I want to parse this date first to make the clock be universal for all the regions.
- You’re not going to do that by yourself right? You know what they say, don’t repeat yourself!
But it’s just two lines.
- Don’t reinvent the wheel!
Literally, Javascript has a built in library for t...
- One component per file!
I’m lost.
- It happens, and you’ll get lost managing your files as well. You should use Webpack or Browserify for managing your modules.
Doesn’t Javascript include that already?
- Yes, but some people still have previous versions of ECMAScript, so it wouldn’t be compatible.
What’s ECMAScript?
- Javascript
Why is it called ECMAScript then?
- It’s called both ways. Anyways, after you install Webpack to manage your modules, you still need a module and dependency manager, such as bower, or node package manager or yarn.
What does that have to do with my page?
- So you can install AngularJS.
What’s AngularJS?
- A Javascript framework that allows you to do complex stuff easily, such as two way data binding!
Oh, that’s great, so if I modify one sentence on a part of the page, it will automatically refresh the other part of the page which is related to the first one and viceversa?
- Exactly! Except two way data binding is not recommended, since you don’t want child components to edit the parent components of your app.
Then why make two way data binding in the first place?
- It’s backed up by Google. You just don’t get it do you?
I have installed AngularJS now, but it seems I have to redefine something called a... directive?
- AngularJS is old now, you should start using Angular, aka Angular 2.
But it’s the same name... wtf! Only 3 minutes have passed since we started talking, how are they in Angular 2 already?
- You mean 3.
2.
- 3.
4?
- 5.
6?
- Exactly.
Okay, I now know Angular 6.0, and use a component based architecture using only a one way data binding, I have read and started using the Design Patterns already described to solve my problem without reinventing the wheel using libraries such as lodash and D3 for a world map visualization of my clock as well as moment to parse the dates correctly. I also used ECMAScript 6 with Babel to secure backwards compatibility.
- That’s good.
Really?
- Yes, except you didn’t concatenate your html into templates that can be under a super Javascript file which can, then, be concatenated along all your Javascript files and finally be minimized in order to reduce latency. And automate all that process using Gulp while testing every single unit of your code using Jasmine or protractor or just the Angular built in unit tester.
I did.
- But did you use TypeScript?36 -
Management : "How long you think it would take?"
Me : "now this is a rough estimate, but I think building the back-end and database alone could take 6-months minimum"
Management : "WHAT ARE YOU TALKING ABOUT? YOU ARE NOT SERIOUS"
me : "its a big proj..."
Management : "I thought it will be something like 10 days, already told the client it can be done"
me : "but we are not ready"
Management : "how are we not ready? we already have the virtual 3D shop, and we can use this ready-to-deploy eCommerce service as our data base "
... "you need to figure this out, this is not acceptable" he continued
* 2 Days Later -talking to my direct boss *
Boss : "since you don't know how to do it..."
me : "what ? I didn't say I can't do it, all I said it will take six months"
Boss : "yeah yeah, anyway there is this studio, a professional polish studio, we called them and they can do it, we will sign a contract with them, this will let you focus on the front-end. good?"
me : "well alright then"
Boss : "please write a doc, explaining everything needed from the backend"
-to me that was the end of it, took a long time to tell me they made the deal-
* 5 Months later *
- "Abdu, can you come here for a minute..."
- "yes boss?"
- "the document we asked you to do for the Polish studio, did you specify that we needed an integration with the API we are using for eCommerce?"
scared to death I answered : "why of course I did!"
I ran to my PC to check it out because I didn't know, I forgot because no one even comment on my doc. I check it out, and it was clearly explained... I got relaxed...
turns out they didn't even do what we asked them for. took them 5 months, and with no communication whatsoever. all their work was useless to us. complete dump waste.
----------------
never mentioned this until a year later... in a heat of moment when they were asking me to make an impossible task with no men and no time... I reminded them of this story... management didn't like it. but it was the truth. they didnt push this crazily this time13 -
So, since I hear from a lot of people (on here and irl) that Linux has a 'very high learning curve', let me share my experiences with the first time my dad touched Linux (Elementary OS) without me interfering at all! (keep in mind that he is very a-technical)
*le me boots the system* (I already did setup a user account for him and gave him the password).
Dad: *enters password and presses enter*
Me: "Hmm that went faster than expected."
Dad: "Uhm I know how to login son, it's not that hard and pretty obvious".
Me: "Alright, why don't you try to open up the default word documents editor on here! I'll be right back!"
Me: *Goes away and returns after a minute*.
Dad: *already a few test sentences typed in LibreOffice writer* it's going pretty well :)!
Me: "Oo how did you find that?!"
Dad: "Well, there's a thingy that says 'applications' so I clicked in and found it in the "Office" section, do you think I am blind or something?!"
Me: 😐. uhm no but I just didn't think you'd find it that quickly. Now try to install Chromium browser! *thinking: he'll fail this one for sure* I'll be right back :).
Me: *returns again after a minute or so*
Dad: *already searching for stuff through Chromium*
Me: "wait, how the hell did you do that so quickly, it's not the easiest thingy for most people".
Dad: "Jesus, it's not that hard! I went to the application browsing thingy, typed 'software' and then a sorta software store icon showed up so I clicked it and it opened a windows with a search bar saying something like 'search for applications/software'. clicked in it, typed 'chromium', saw it coming up, there was a very clear 'install' button, it asked for my password, I put it in and after a little it gave a notification that it was installed. Then I went to that application browsing thingy again and typed Chromium. Then I hit enter because it selected an icon called chromium...."
Me: O.o. Okay this is going very good, now open an email client and login to your email address!
Dad: *goes to application browsing thingy, types 'email', evolution icon shows up, dad clicks it, email address setup steps show up and dad follows them quickly. After about a minute, everything is setup.
I expected this to be a hard process for someone who dealt with Windows his entire life but damn, I underestimated it.
Asked him if he found it easy/what he liked about it:
"Well, it's very clear where I can find everything, default browser/email/word document editor programs are easy to find and that's about all I need so yeah, great system!"
I am proud of you, dad!77 -
wk87 is a dangerous topic for me, i've been through a lot. I apologise for what I am about to inflict on this network over the coming week.
Most incompetent co-worker, candidate 1, "T".
T was an embedded C developer who talked openly about how he's been writing code since he was 14, knew all the C system libraries and functions like the back of his hand. For the most part, he did ... but not how to actually use them, as (based on his shocking ... well everything) he was inflicted by some sort of brain disorder not yet fully understood by medical science. Some highlights:
- Myself and the CTO spent 4 days teaching him what a circle buffer was and how to build one.
- His final circle buffer implementation had about 3 times as much code as he actually needed.
- When the code was running too slowly on the device, we didn't try find any performance improvements, or debug anything to see if there was anything taking too long. No not with T, T immediately blamed TCP for being inefficient.
- After he left we found a file called "TCP-Light" in his projects folder.
- He accused the CTO of having "violent tendencies" because he was playing with a marker tossing it up in the air and catching it.
- He once managed to leave his bank statements, jumper and TROUSERS in the bathroom and didn't realise until a building wide email went out.
- He once .... no hang on, seriously his fucking trousers, how?
- He accused us all of being fascists because we gave out to him for not driving with his glasses, despite the fact his license says he needs to (blind as a bat).
... why were his trousers off in the first place? and how do you forget ... or miss the pile of clothes and letters in a small bathroom.
Moving on, eventually he was fired, but the most depressing thing of all about T, is that he might not even be top of my list.
Tune in later for more practiceSafeHex's most incompetent co-worker!!!11 -
Frack he did it again.
In a meeting with the department mgr and going over a request feature *we already discussed ad nauseam* that wasn’t technically feasible (do-able, just not worth the effort)
DeptMgr: “I want to see the contents of web site A embedded in web site B”
Me: “I researched that and it’s not possible. I added links to the target APM dashboard instead.”
Dev: “Yes, it’s possible. Just use an IFrame.”
DeptMgr: “I thought so. Next sprint item …what’s wrong?…you look frustrated”
Me: “Um..no…well, I said it’s not possible. I tried it and it doesn’t work”
Dev: “It’s just an IFrame. They are made to display content from another site.”
Me: “Well, yes, from a standard HTML tag, but what you are seeing is rendered HTML from the content manager’s XML. It implemented its own IFrame under the hood. We already talked about it, remember?”
Dev: “Oh, that’s right.”
DeptMgr: “So it’s possible?”
Dev: “Yea, we’ll figure it out.”
Me: “No…wait…figure what out? It doesn’t work.”
Dev: “We can use a powershell script to extract the data from A and port it to B.”
DeptMgr: “Powershell, good…Next sprint item…”
Me: “Powershell what? We discussed not using powershell, remember?”
Dev: “It’s just a script. Not a big deal.”
DeptMgr: “Powershell sounds like a right solution. Can we move on? Next sprint item….are you OK? You look upset”
Me: “No, I don’t particularly care, we already discussed executing a powershell script that would have to cross two network DMZs. Bill from networking already raised his concern about opening another port and didn’t understand why we couldn’t click a link. Then Mike from infrastructure griped about another random powershell script running on his servers just for reporting. He too raised his concern about all this work to save one person one click. Am I the only one who remembers this meeting? I mean, I don’t care, I’ll do whatever you want, but we’ll have to open up the same conversations with Networking again.”
Dev: “That meeting was a long time ago, they might be OK with running powershell scripts”
Me: “A long time ago? It was only two weeks.”
Dev: “Oh yea. Anyway, lets update the board. You’ll implement the powershell script and I’ll …”
Me: “Whoa..no…I’m not implementing anything. We haven’t discussed what this mysterious powershell script is supposed to do and we have to get Mike and Bill involved. Their whole team is involved in the migration project right now, so we won’t see them come out into the daylight until next week.”
DevMgr: “What if you talk to Eric? He knows powershell. OK…next sprint item..”
Me: “Eric is the one who organized the meeting two weeks ago, remember? He didn’t want powershell scripts hitting his APM servers. Am I the only one who remembers any of this?”
Dev: “I’m pretty good with powershell, I’ll figure it out.”
DevMgr: “Good…now can we move on?”
GAAAHH! I WANT A FLAMETHROWER!!!
Ok…feel better, thanks DevRant.11 -
Me: *Applies for entry level full-stack job*
Recruiter: "Sorry, I can't hire you because you don't have the years of experience we're looking for. We can take you on as an intern! Unpaid of course, while we train you."🙂
Clueless Me: "Sure, why not."
*second day into the internship*
Boss: "I have this really big project, and I want you to be the lead. I'm going to be very vague about what I want, so you'll constantly have to make changes to user stories, wireframes, & database designs until I'm satisfied. Don't ask me any questions for clarity, because I'm busy 🙂"
Silly Me: "okay"
Boss: "Also, can you train all the other interns? You're so lucky! You'll get to pick the best to join your team" 🙂
Stupid Me: "okay"
Boss: *emails me a spreadsheet of 80 Front-End interns (freshmen and sophomores)*
"Did you start building the app yet?" 🙂
Me (Dummy): "You haven't approved the final wireframes ye-"
Boss: "And for the other interns' training, what did you have in mind?" 🙂
Me (Dumbass): "I made a training guide, they're already followi-"
Boss: "My project manager for this other project left, guess he couldn't handle the pressure of a real job... HAHAHAHA! You're gonna take the lead of that project, too!"
*Adds me to the slack group* 😁
Me (Imbecile): "Wha-"
Boss: "And we've been having trouble with keeping track of everyone's code. Is there something we can do instead of slacking code snippets back and forth?" 🤔😮
Me (Fucking Imbecile): "Wait, you guys are working on a project and you don't have any form of version control? Maybe we should take a few steps back and plan thi-"
Boss: "Are you gonna take initiative or not!?" 😡
Me (Enlightened): "I quit." 😑
Former Boss: "Too bad... I was going to offer you a paid role tomorrow morning. Oh well!" 😔35 -
I think I'm losing my mind working in the IT Department. 😂 Sometimes the questions are UNBELIEVABLE!
Client: Hi, my computer is not working.
Me: Hi, what's wrong with it?
Client: IDK. It won't work.
Me: Alright, what do you see on your screen?
Client: Nothing!
Me: Nothing as in there are no icons on your desktop or black screen?
Client: Oh, black screen.
Me: Is your monitor on? Do you see a light on the power-on button?
Client: Yes, it's white.
Me: Ok, good. What about your computer? Is it turned on?
Client: Well, I never turn off my computer so I assume it's on. I leave it as is when I leave the office then log-in in the morning when I come in.
**At this point I realized this person doesn't even lock the computer until it locks by itself after a while.
Me: Ok please turn on your computer by pressing the power button with a thin line on it. It should turn white.
Client: Ok but as I said I don't turn it off so why should I turn it on? Did it turn off by itself?
Me: That can happen.
Client: Ok....oh wait, it working! Thank you so much. Sorry if I was a little pain. I am a little stressed out this morning.
Me: No problem. Glad it worked. Have a good day.
*Hangs up confused. I mean really confused. Smh18 -
You know what?
Young cocky React devs can suck my old fuckin LAMP and Objective-C balls.
Got a new freelance job and got brought in to triage a React Native iOS/Android app. Lead dev's first comment to me is: "Bro, have you ever used React Native".
To which I had to reply to save my honor publicly, "No, but I have like 8 years with Objective-C and 3 years with Swift, and 3 years with Node, so I maybe I'll still be able help. Sometimes it just helps to have a fresh set of eyes."
"Well, nobody but me can work on this code."
And that, as it turned out was almost true.
After going back and forth with our PM and this dev I finally get his code base.
"Just run "npm install" he says".
Like no fuckin shit junior... lets see if that will actually work.
Node 14... nope whole project dies.
Node 12 LTS... nope whole project dies.
Install all of react native globally because fuck it, try again... still dies.
Node 10 LTS... project installs but still won't run or build complaining about some conflict with React Native libraries and Cocoa pods.
Go back to my PM... "Um, this project won't work on any version of Node newer than about 5 years old... and even if it did it still won't build, and even if it would build it still runs like shit. And even if we fix all of that Apple might still tell us to fuck off because it's React Native.
Spend like a week in npm and node hell just trying to fucking hand install enough dependencies to unfuck this turds project.
All the while the original dev is still trying TO FIX HIS OWN FUCKING CODE while also being a cocky ass the entire time. Now, I can appreciate a cocky dev... I was horrendously cocky in my younger days and have only gotten marginally better with age. But if you're gonna be cocky, you also have to be good at it. And this guy was not.
Lo, we're not done. OG Dev comes down with "Corona Virus"... I put this in quotes because the dude ends up drawing out his "virus" for over 4 months before finally putting us in touch with "another dev team he sometimes uses".
Next, me and my PM get on a MS Teams call with this Indian house. No problems there, I've worked with the Indians before... but... these are guys are not good. They're talking about how they've already built the iOS build... but then I ask them what they did to sort out the ReactNative/Cocoa Pods conflict and they have no idea what I'm talking about.
Why?
Well, one of these suckers sends a link to some repo and I find out why. When he sends the link it exposes his email...
This Indian dude's emails was our-devs-name@gmail.com...
We'd been played.
Company sued the shit out of the OG dev and the Indian company he was selling off his work to.
I rewrote the app in Swift.
So, lets review... the React dev fucked up his own project so bad even he couldn't fix it... had to get a team of Indians to help who also couldn't fix it... was still a dickhead to me when I couldn't fix it... and in the end it was all so broken we had to just do a rewrite.
None of you get npm. None of you get React. None of you get that doing the web the way Mark Zucherberg does it just makes you a choad locked into that ecosystem. None of you can fix your own damn projects when one of the 6,000 dependency developers pushes breaking changes. None of you ever even bother with "npm audit fix" because if security was a concern you'd be using a server side language for fucking server side programming like a grown up.
So, next time a senior dev with 20 years exp. gets brought in to help triage a project that you yourself fucked up... Remember that the new thing you know and think makes you cool? It's not new and it's not cool. It's just JavaScript on the server so you script kiddies never have to learn anything but JavaScript... which makes you inarguably worse programmers.
And, MF, I was literally writing javascript while you were sucking your mommas titties so just chill... this shit ain't new and I've got a dozen of my own Node daemons running right now... difference is?
Mine are still working.34 -
Client: "This has been broken for weeks! Why is it still broken!?!?"
Me: "Did you tell anyone it was broken?"
Client: "Well...um...no..."
I may be good at my job, but I have not been able to (nor do I want to) develop mind-reading abilities. Now please fuck off (so that I can go fix it).7 -
Linux sucks.
Now now, chill. I'm using it as my main OS for a few years now. I know what I'm talking and this title is a bit click-baity, but this just has to go out there:
1. It's usable as a Windows replacement just fine - FALSE. XFCE4 is years old and buggy as hell especially on multi-monitor set-up, Gnome3 gets stuck more often than my Windows 98 machine used to, KDE is like a rich kid on meth. Plug in Bluetooth headphones? Well no, sorry, you have to research that online, since you'll probably need to install some packages for it to work. Did I say "work"? Well no, because after more research you realize that Debian on Gnome3 on gdm3 launches pulseaudio on its own, so you have 2 instances of pulseaudio, and one of them is stealing your headphones sometimes and you either have no sound or shitty sound. How do I know that you ask? The same way I know everything else - every time you try to do something new on any Linux, it involves a ton of research. Exciting research, don't get me wrong, but at this point it looks more like a toy than a reliable desktop computer operating system.
2. And why am I using pulseaudio? Why not alsa? years ago people were discussing on forums that pulseaudio is old and dead, yet here we are with new LTS release of Ubuntu still shining with Pulseaudio. How about several different service management systems being deprecated by new ones, each having different configurations and calling methods? Apparently systemd is old and lame now. It's a mix of 10 year old software that works badly, with a 5 year old replacement that works worse, somehow trying to live under the same roof. Does it work? Ask my headphones who sound like a fucking dial-up modem.
3. Let's talk about displays, shall we? xorg is old and deprecated, right? We got Wayland that's mostly stable. Don't know what that is? That's just basic knowledge for Linux. And when you try to install network-manager, it also tries to install Mir toolkits. Because why the fuck not install 3 display managers when you want a network manager, of which one is old and dying, one is young and stupid, and another is an infant that died of cancer?
4. Want to integrate with Google Drive? Yeah, there's a tool that mounts the drive as a local directory. Yeah only for Ubuntu. Want it on Debian? You need to compile it. Oh wait, it's on Ocaml, because fuck mainstream languages, we're hipsters. How do you compile Ocaml? Well you need to have Ocaml on your system, dummy. How do you do that? Well you need to compile Ocaml. Ok, how do I do that? Well, git clone, download and install some dependencies, configure, make... oh sorry, you're using libssl1.0.2g when you need libssl1.0.1f, nope, sorry, won't work. Want to install libssl1.0.1f? Why? You already have the "g", stupid! Want to remove libssl1.0.2g? Bye-bye literally everything that you have on your PC. But at least you got the "f". Does it work now? Well no, because you need libssl1.0.2g for another dependency to work.
And all I ever wanted was to get a fucking document from google drive (not nudes, I promise).
5. Want to watch a movie? Let me tear that screen in half and make the bottom half late by a couple of frames, because who needs vertical sync, right? Oh you do? Well install the native drivers maybe. Oh you have? Welcome to eternal Boot to Recovery mode, motherfucka!
---------------------------------
Yeah, most of the times things work just fine. But the reason I know what those things are and how they work is not curiosity. The reason that I know the inner workings of Linux much better than the inner workings of Windows, is because in those few years that I've been using it full time, it has caused me 10 times more headache than I have ever experienced with other systems. And it's not the usual annoyances like "OMG it rebooted when I didn't ask it to", but more like "Oh, it won't work and I need 2 days to find out why" kind of stuff, because even if you experience the same thing again, it's always caused by some new shit and the old solution won't work any more.
I still love it, and will continue to use it. I don't know why really. Maybe because I'm not afraid of fucking it up any more? Maybe because I can do what I want in it and recovering will be easier than on Windows?
It's a toy for me, after all these years. And I also use it for professional reasons.
But whenever someone presents it as a better alternative to Windows, I just want to puke.51 -
The way 90% of the population wears their face masks really explains a lot about their approach to using software, apps & websites as well.
I feel like giving up.
I am not a developer for the salary, or just to solve analytical puzzles. Those are motivators, but my main drive is to make the world more comfortable and enjoyable, better optimized, build ethical services which bring happiness into people's lives. I want to improve society, even if it's just a tiny bit.
But if users invest absolutely zero percent of their limited brain capacity into understanding a product that already has a super-clean design and responds with helpful validation messages...
...why the fuck bother.
I used to think of the gap between technology and tech-incompetent people as an optimization problem.
As something which could be fixed by spending a fortune on UX research. Write tests, hire QA employees, decrease tech debt, create a bold but unified & simple design.
But the technologically incompetent just get more entitled with every small thing you simplify.
It's never fucking fool-proof enough.
Why can't I upload a 220MB PDF as profile picture? Why doesn't the app install on my 9 year old Android Froyo phone? Why can't I sign up if my phone number contains a  U+FFFC? Why does this page load so slowly from my rural concrete bunker in East Ukraine? WHY DO I HAVE PNEUMONIA, HOW DID I GET INFECTED EVEN THOUGH I WAS WEARING A MOUTH MASK ON MY FOREHEAD?
This is why I ran away from Frontend, to Backend, to DBA.
If I could remove myself further from the end user, I would.
At least I still have a full glass of tawny port and a huge database which needs to be normalized & migrated.
Fuck humans, I'm going to hug a server.21 -
I am an indie game developer and I lead a team of 5 trusted individuals. After our latest release, we bought a larger office and decided to expand our team so that we could implement more features in our games and release it in a desirable time period. So I asked everyone to look for individuals that they would like to hire for their respective departments. When the whole list was prepared, I sent out a bunch of job offers for a "training trial period". The idea was that everyone would teach the newbies in their department about how we do stuff and then after a month select those who seem to be the best. Our original team was
-Two coders
-One sound guy(because musician is too mainstream)
-Two artists
I did coding, concept art(and character drawings) and story design, So, I decided to be a "coding mentor"(?).
We planned to recruit
-Two coders
-One sound guy
-One artist (two if we encountered a great artstyle)
When the day finally arrived I decided to hide the fact that I am the founder and decided that there would be a phantom boss so that they wouldn't get stressed or try flattery.
So out of 7, 5 people people came for the "coding trial session". There were 3 guys and 2 girls. My teammate and I started by giving them a brief introduction to the working of our engine and then gave them a few exercises to help them understand it better. Fast forward a few days, and we were teaching them about how we implement multiple languages in our games using Excel. The original text in English is written in the first column and we then send it to translators so that they can easily compare and translate the content side by side such that a column is reserved for each language. We then break it down and convert the whole thing into an engine friendly CSV kind of format. When we concluded, we asked them if they had any questions. So there was this smartass, who could not get over the fact that we were using Excel. The conversation went like this:(almost word to word)
Smartass: "Why would you even use that primitive software? How stupid is that? Why don't you get some skills before teaching us about your shit logic?"
Me:*triggered* "Oh yeah? Well that's how we do stuff here. If you don't like it, you can simply leave."
Smartass: "You don't know who I am, do you? I am friends with the boss of this company. If I wanted I could have all of you fired at whim."
Me:"Oh, is that right?"
Smartass:"Damn right it is. Now that you know who I am, you better treat me with some respect."
Me: "What if I told you that I am not just a coder?"
Smartass:"Considering your lack of skills, I assume that you are also a janitor? What was he thinking? Hiring people like you, he must have been desperate."
Me:"What if I told you that I am the boss?"
Smartass:"Hah! You wish you were."*looks towards my teammate while pointing a thumb at me* "Calling himself the boss, who does he think he is?"
Teammate:*looks away*.
Smartass:*glances back and forth between me and my teammate while looking confused* *realizes* *starts sweating profusely* *looks at me with horror*
Me:"Ha ha ha hah, get out"
Smartass:*stands dumbfounded*
Me:"I said, get out"
Smartass:*gathers his stuff and leaves the room*
Me: "Alright, any questions?"*Smiling angrily*
Newcomers: *shake heads furiously*
Me:"Good"
For the rest of the day nobody tried to bother me. I decided to stop posing as an employee and teaching the newcomers so that I could secretly observe all sessions that took place from now on for events like these. That guy never came back. The good news however, is that the art and music training was going pretty well.
What really intrigues me though is that why do I keep getting caught with these annoying people? It's like I am working in customer support or something.16 -
At the beginning of an interview...
HR girl: You know, that position you applied is already taken but I found some similar in our company.
Me: Uhm, ok?
HRG: What about this one? It's some programming... *pointing at some IT position regarding db maintenance* Do you want to try that?
Me: Sure, why not.
I was applying to student position at embedded firmware development at the time. I did some school project with MySQL but it was few years back and I happily forgot most about it.
Anyway, story continues.
IT manager: Hi, I heard you want to join our lines.
Me: That is what I heard as well.
IT: Eh?
Me: I came for completely different position actually.
IT: Uhm, ok. We have standardised test, let's see what you can do.
It was some basic stuff for db guys but I was totally lost. I was done after 3 minutes returning nearly blank paper.
We shaked hands, both agreed this is not well fit for me and I went away.
After this botched attempt HR girl remembered that there is another team looking for embedded developer students. I was accepted.
Corporates are marvelous.3 -
A wild Darwin Award nominee appears.
Background: Admins report that a legacy nightly update process isn't working. Ticket actually states problem is obviously in "the codes."
Scene: Meeting with about 20 people to triage the issue (blamestorming)
"Senior" Admin: "update process not working, the file is not present"
Moi: "which file?"
SAdmin: "file that is in ticket, EPN-1003"
Moi: "..." *grumbles, plans murder, opens ticket*
...
Moi: "The config dotfile is missing?"
SAdmin: "Yes, file no there. Can you fix?"
Moi: "Engineers don't have access to the production system. Please share your screen"
SAdmin: "ok"
*time passes, screen appears*
Moi: "ls the configuration dir"
SAdmin: *fails in bash* > ls
*computer prints*
> ls
_.legacyjobrc
Moi: *sees issues, blood pressure rises* "Please run list all long"
SAdmin: *fails in bash, again* > ls ?
Moi: *shakes* "ls -la"
SAdmin: *shonorable mention* > ls -la
*computer prints*
> ls -la
total 1300
drwxrwxrwx- 18 SAdmin {Today} -- _.legacyjobrc
Moi: "Why did you rename the config file?"
SAdmin: "Nothing changed"
Moi: "... are you sure?"
SAdmin: "No, changed nothing."
Moi: "Is the job running as your account for some reason?"
SAdmin: "No, job is root"
Moi: *shares screenshot of previous ls* This suggests your account was likely used to rename the dotfile, did you share your account with anyone?
SAdmin: "No, I rename file because could not see"
Moi: *heavy seething* so, just to make sure I understand, you renamed a dotfile because you couldn't see it in the terminal with ls?
SAdmin: "No, I rename file because it was not visible, now is visible"
Moi: "and then you filed a ticket because the application stopped working after you renamed the configuration file? You didn't think there might be a correlation between those two things?"
SAdmin: "yes, it no work"
Interjecting Director: "How did no one catch this? Why were there no checks, and why is there no user interface to configure this application? When I was writing applications I cared about quality"
Moi: *heavy seething*
IDjit: "Well? Anyone? How are we going to fix this"
Moi: "The administrative team will need to rename the file back to its original name"
IDjit: "can't the engineering team do this?!"
Moi: "We could, but it's corporate policy that we have no access to those environments"
IDjit: "Ok, what caused this issue in the first place? How did it get this way?!"
TFW you think you've hit the bottom of idiocy barrel, and the director says, "hold my mango lassi."27 -
Here's a recent interview I had for an Android Developer job:
I: Interviewer, M: Me
I: hello, welcome
M: hi, thanks
I: do you know Kotlin?
M: yes, I've been working with it for 1.5 years and have written 3 projects in it
I: do you know RxJava, Dagger, Retrofit, and how to make Custom Views?
M: yes, I'm comfortable with them *explains*
I: do you know Room?
M: yes I do, I've done a lot of practices in it, but unfortunately have never needed to use it in production
I: what architecture do you use? Do you know MVP?
M: I'm currently using MVVM, but not MVP. I've debugged projects in it so I know what's going on in it
I: ok, do you have any questions for us?
M: how did I do?
I: I'm sorry sir, but you're not even a junior here
M: what? Why is that?
I: well you don't know Room and MVP?
M: I said I know them, just haven't used them in production.
I: well you have 3 years of experience but you dont even know Kotlin!
M: Kotlin was your first question and I said I have 3 projects in it. Did you even check the samples you asked for in the job posting?
I: SIR YOU'RE NOT A GOOD FIT FOR US, THANK YOU FOR COMING.
:/56 -
*Facebook Hackers follow the Rules*
(real story)
TL;DR: sorry, not available, can't do spoilers
One night I was with a group of friends out at a pub. A guy and his girlfriend show up, I didn't know them but they were my friend's friends.
The girl kept bragging the whole time about his boyfriend being a professional programmer, trying to remind it to everybody whenever possible (don't ask me why!).
So, after a while, the discussion moves towards "suspect Facebook activities" and the guy starts saying that he can hack Facebook.
- "What do you mean?", I ask.
- "Hacking into other people's accounts, even with 2 factor authentication. I did it a lot of times"
- "Wait, and they don't notice?"
- "Of course not! ^_^ He's a hacker", the girl replies.
Ok, time to do a coming out.
- "Hey, I'm a developer myself. Can you give me an idea of what you did in technical terms? Did you find a vulnerability? Used a virus? Maybe a keylogger?"
- "No... Uh... Well... The secret is to read the terms of service"
- "What?"
- "Yes... yes it's all in the facebook terms of service..."
- "Uhm, I'm not really sure I'm following. Could you prove it by hacking my Facebook account? I'm giving you the permission".
In less than a minute the discussion flew completely away and they never mentioned computers again.
😂😂8 -
Client: Can you provide some kind of guaranteed timeline that you're going to be able to move our website to our new servers with the optimizations implemented? I know you said it should take a week, but we have 3 weeks to get this moved over and we cannot afford to be double billed. I'm waiting to fire up the new server until you can confirm.
Me: As I said, it SHOULD take about a week, but that's factoring in ONLY the modifications being made for optimization and a QA call to review the website. This does not account for your hosting provider needing to spin up a new server.
We also never offered to move your website over to said new server. I sent detailed instructions for your provider to move a copy of the entire website over and have it configured and ready to point your domain over to, in order to save time and money since your provider won't give us the access necessary to perform a server-to-server transfer. If you are implying that I need to move the website over myself, you will be billed for that migration, however long it takes.
Client: So you're telling me that we paid $950 for 10 hours of work and that DOESN'T include making the changes live?
Me: Why would you think that the 10 hours that we're logged for the process of optimizing your website include additional time that has not been measured? When you build out a custom product for a customer, do you eat the shipping charges to deliver it? That is a rhetorical question of course, because I know you charge for shipping as well. My point is that we charge for delivery just as you do, because it requires our time and manpower.
All of this could have been avoided, but you are the one that enforced the strict requirement that we cannot take the website down for even 1 hour during off-peak times to incorporate the changes we made on our testbed, so we're having to go through this circus in order to deliver the work we performed.
I'm not going to give you a guarantee of any kind because there are too many factors that are not within our control, and we're not going to trap ourselves so you have a scapegoat to throw under the bus if your boss looks to you for accountability. I will reiterate that we estimate it would take about a week to implement, test and run through a full QA together, as we have other clients within our queue and our time must be appropriately blocked out each day. However, the longer you take to pull the trigger on this new server, the longer it will take on my end to get the work scheduled within the queue.
Client: If we get double billed, we're taking that out of what we have remaining to pay you.
Me: On the subject of paying us, you signed a contract acknowledging that you would pay us the remaining 50% after you approved the changes, which you did last week, in order for us to deliver the project. Thank you for the reminder that your remaining balance has not yet been paid. I'll have our CFO resend the invoice for you to remit payment before we proceed any further.
---
I love it when clients give me shit. I just give it right back.6 -
Manager: Why did you clear the data from the database? The client is now specifically requesting it and we don’t have it anymore!
Dev: You told me to.
Manager: Well why did you listen? It’s obvious now that that data was very important and should have been kept!
Dev: Last time you told me to do something that wasn’t a good idea I tried to explain why and told me not to question you ever again and that doing so was “disrespectful” and then threatened to have me fired. So now I just go along with what you say and let you suffer the consequences of not listening.
Manager: Well don’t do that then! It’s obviously not working very well! It’s ok to disagree with me you just have to make sure that what you think is something I agree with!
Dev: …10 -
So, I'm programming a control system for a prototype aerospace vehicle. You know, the stuff that needs to work to prevent falling out of the sky.
Anyway, test day was today (was -- not anymore). Wiring all the electronics, everything is actuating and works well. Except for one part, a little thruster for stability.
I spent hours - literally, fucking hours - trying to fix the problem. Wrong address? Wrong syntax? I had absolutely no clue what was wrong. Queue the hardware guy, $stupid:
$stupid: "How have you not got it working yet?!"
$me: "I don't know, everything I'm trying isn't working. I've spent hours digging through this code and nothing is fucking working."
$stupid: "Well have you set it up for the new thruster?"
$me: "What...What new thruster?"
$stupid: "Oh, the one we installed this morning, did noone tell you?"
WHY WOULDN'T YOU TELL ME THIS?! COMMUNICATION 101!6 -
Storytime!
This customer comes in and practically throws a computer on the counter.
Customer: This computer isn't working. I've ran the diagnostics and it says it's software. *places a dvd case with a 32 bit Windows 7 disk in it on the counter* It had Windows 10 on it, but I want Windows 7 on it.
Me: Well, you may have issues with the drivers if you put Windows 7 on it--
Customer: I don't care, I just want Windows 7.
Me: You SHOULD care. That means no wifi, no display, no mouse... Windows 7 doesn't like Windows 10 hardware.
Customer: Then... check to see Windows 7 compatibility!
Me: Alright.... *makes notes to check for Windows 7 compatibility*
Me: So has this Windows 7 been used before?
Customer: Yes, it has.
Me: On how many computers?
Customer: I've installed it on two computers and it works just fine.
Me: That's weird because Windows license keys are for one computer only. Are both of them connected to the internet?
Customer: Yes.
Me: Well, okay then... *finishes up ticket*
Customer: I work in this field and I just don't understand why they don't come with the disks anymore. How much is a Windows 10 disk?
Me: *gives price*
Customer: And do you have any?
Me: Let me check *I go to where they are, find some and come back out*
Me: Unfortunately we're out at the moment and would have to special order some back in.
Customer: OK. So then how much to fix this computer?
Me: *price of installing Windows and backing up data*
Customer: That's halfway to the price of a new one of these!
Me: Well yes, an HP at Walmart... But you do have that option if you want to take it.
Customer: Well, why does it cost that much?
Me: Well, it's $labor1 to install Windows, $labor2 to do some basic setup and drivers, and $labor3 to backup and restore data.
Customer: Oh, well I don't want data.
Me: Okay, well then it would be $total - $labor3
Customer: ...Okay, fine
Me: *updates the ticket*
When she finally left I put it on the bench and the first message said "SMART ERROR." I then did 4 different tests that said "lol, the hard drive is failing."
If you "worked in this field," you would know that a SMART error is hard drive related.
If you worked in this field, you would know that Windows is only a 1PC license, so why are you lying about installing it with no issues on other computers?
If you worked in this field, you would know you would want a 64bit Windows on your computer.
If you worked in this field, you would know how to find a Windows 10 installation media online.
If you worked in this field, you would know that HPs are not good computers to get.
IF YOU FUCKING WORKED IN THIS FIELD YOU WOULDN'T BE SUCH A FUCKING CUNT.17 -
Was at my sisters place a little ago and somehow we came at the subject of her laptop.
For everyone who thinks I'm posting this solely to hate on windows, I'm not. This really happened and if you don't believe it, well, so be it, I guess.
Also keep in mind that's she's using a stock version without anything except for word and itunes installed.
She got it a couple of years ago and I dual booted it for her (windows + ubuntu). I fully expected her to use windows because of office and outlook etc.
Asked her anyways:
Me: So, you've got dual boot, although I think already know the answer, what system do you use mostly? (I didn't even consider that there was a possibility that the answer would be ubuntu or linux)
Sister: Ubuntu!
Me:
Me:
Me:
Me:
Me:
Me:
Me:
Me: 😵
Me: Sorry, what? You're not using windows as primary system?!
Sister: No. It at first takes that motherfucking system about 5 minutes to reach the FUCKING LOGIN SCREEN.
Me: Ow, that's bad :/
Me: *turns laptop on and indeed, it takes a fuckton of time*
Me: Is the password still the same as when I set it up for you?
Sister: Yesss.
Me: *types the password, it's working, loading screen appears*
Sister: Would you like a coffee?
Me: Uhm.... sure? But that would take you about 10-15 minutes to make.......?
Sister: Yes. And that's exactly how long it takes before that fucking piece of shit called windows has finally loaded the FUCKING DESKTOP.
Me: 😅
Me: Okay but it can't be that bad, right? I mean, I hate windows but you mostly need it for studies and such and as you know I'm not judging you for tha......
Sister: YES IT IS THAT FUCKING BAD. WHEN I'M IN CLASS, IT TAKES HALF THE FUCKING CLASS TO LOAD BEFORE I CAN OPEN WORD OR WHAT-THE-FUCK EVER.
THAT'S WHY I USE UBUNTU PRIMARILY, BECAUSE, ALTOUGH IT'S NOT MY FAVOURITE SYSTEM, IT. JUST. FUCKING. WORKS.
Well, I did definitely NOT see that one coming!
There is some bloatware on there but definitely as bad as what would cause this. Virus scan turned up empty. No. Fucking. Clue.
It's not a gaming laptop or anything but come on, it should run either windows or linux very well.51 -
Worst thing you've seen another dev do? Long one, but has a happy ending.
Classic 'Dev deploys to production at 5:00PM on a Friday, and goes home.' story.
The web department was managed under the the Marketing department, so they were not required to adhere to any type of coding standards and for months we fought with them on logging. Pre-Splunk, we rolled our own logging/alerting solution and they hated being the #1 reason for phone calls/texts/emails every night.
Wanting to "get it done", 'Tony' decided to bypass the default logging and send himself an email if an exception occurred in his code.
At 5:00PM on a Friday, deploys, goes home.
Around 11:00AM on Sunday (a lot folks are still in church at this time), the VP of IS gets a call from the CEO (who does not go to church) about unable to log into his email. VP has to leave church..drive home and find out he cannot remote access the exchange server. He starts making other phone calls..forcing the entire networking department to drive in and get email back up (you can imagine not a group of happy people)
After some network-admin voodoo, by 12:00, they discover/fix the issue (know it was Tony's email that was the problem)
We find out Monday that not only did Tony deploy at 5:00 on a Friday, the deployment wasn't approved, had features no one asked for, wasn't checked into version control, and the exception during checkout cost the company over $50,000 in lost sales.
Was Tony fired? Noooo. The web is our cash cow and Tony was considered a top web developer (and he knew that), Tony decided to blame logging. While in the discovery meeting, Tony told the bosses that it wasn't his fault logging was so buggy and caused so many phone calls/texts/emails every night, if he had been trained properly, this problem could have been avoided.
Well, since I was responsible for logging, I was next in the hot seat.
For almost 30 minutes I listened to every terrible thing I had done to Tony ever since he started. I was a terrible mentor, I was mean, I was degrading, etc..etc.
Me: "Where is this coming from? I barely know Tony. We're not even in the same building. I met him once when he started, maybe saw him a couple of times in meetings."
Andrew: "Aren't you responsible for this logging fiasco?"
Me: "Good Lord no, why am I here?"
Andrew: "I'll rephrase so you'll understand, aren't you are responsible for the proper training of how developers log errors in their code? This disaster is clearly a consequence of your failure. What do you have to say for yourself?"
Me: "Nothing. Developers are responsible for their own choices. Tony made the choice to bypass our logging and send errors to himself, causing Exchange to lockup and losing sales."
Andrew: "A choice he made because he was not properly informed of the consequences? Again, that is a failure in the proper use of logging, and why you are here."
Me: "I'm done with this. Does John know I'm in here? How about you get John and you talk to him like that."
'John' was the department head at the time.
Andrew:"John, have you spoken to Tony?"
John: "Yes, and I'm very sorry and very disappointed. This won't happen again."
Me: "Um...What?"
John: "You know what. Did you even fucking talk to Tony? You just sit in your ivory tower and think your actions don't matter?"
Me: "Whoa!! What are you talking about!? My responsibility for logging stops with the work instructions. After that if Tony decides to do something else, that is on him."
John: "That is not how Tony tells it. He said he's been struggling with your logging system everyday since he's started and you've done nothing to help. This behavior ends today. We're a fucking team. Get off your damn high horse and help the little guy every once in a while."
Me: "I don't know what Tony has been telling you, but I barely know the guy. If he has been having trouble with the one line of code to log, this is the first I've heard of it."
John: "Like I said, this ends today. You are going to come up with a proper training class and learn to get out and talk to other people."
Over the next couple of weeks I become a powerpoint wizard and 'train' anyone/everyone on the proper use of logging. The one line of code to log. One line of code.
A friend 'Scott' sits close to Tony (I mean I do get out and know people) told me that Tony poured out the crocodile tears. Like cried and cried, apologizing, calling me everything but a kitchen sink,...etc. It was so bad, his manager 'Sally' was crying, her boss 'Andrew', was red in the face, when 'John' heard 'Sally' was crying, you can imagine the high levels of alpha-male 'gotta look like I'm protecting the females' hormones flowing.
Took almost another year, Tony released a change on a Friday, went home, web site crashed (losses were in the thousands of $ per minute this time), and Tony was not let back into the building on Monday (one of the best days of my life).10 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
So I own a webshop together with a guy I met at one of my previous contract jobs. He said he had a great idea to sell product X because he can get them very cheap from another European country. Actually it is a great idea so we decided to work together on this: I do everything tech related, he does the non tech stuff.
Now we are more than 1 year in business. I setup a VPS, completely configured it, installed and setup the complete webshop, built 2 custom PrestaShop modules, built many customizations, built a completely new order proces (both front and back end), advertised quite some products, did some link building, ensured everything is in place to do proper SEO, wrote some content pages, did administration and tax declarations, rewrote a part of a PrestaShop component because it was so damn inefficient and horribly slow, and then some more. Much more.
He did customer relation management, supplier management and some ad words campaigns. Promised me many times to write the content for our product pages. This guy has an education in marketing but literally said: I'm not gonna invest in creating some marketing plan. I have no ambition in online marketing.
What?! You have the marketing knowledge and skills but refuse to use it to market our webshop and business? What the fuck is wrong with you?!
Today he says to me: 'Hey man, this is becoming an expensive hobby as we don't sell much and have lots of costs. I don't understand why I should be the one to write these content pages. Everything you did in the past 8 months can be done in less than 20 hours! You are a joke and just made it a big deal by spreading your work over so many months. I know for sure because I currently work at a company where I'm surrounded by front end devs! Are you fucking crazy?! You're a liar.'
He talks like this to me every 2 months or so while he can't even deliver the content for 1 single product in 6 fuckin' months! We even had to refund a few of our customers because Mr. client relations manager didn't respond to their e-mails within 1 fucking week!! So I asked him how could that have happened as you do the client relations and support. Well, he replied to me: 'Why didn't YOU respond to our clients? You don't log on in our back office at least once a day?!'.
Of course I do asshole. But YOU don't. He replied that I was lying just like I was lying about what I did for our business.
So, asshole, let's have a look at PrestaShops logs to see who's logging in daily. Well, you can probably guess who's IP was there in most of the entries. It wasn't his.
So, what the fuck have you been doing then?! You can't even manage to respond quickly to a client?!! We have maybe 50 clients and if we get 1 question a month by email it is already a lot. But you keep bitching, complaining and insulting me instead?!!!
Last time he literally admitted on a WhatsApp conversation that he had and still has the hope that he could just sit back and relax and watch me do ALL the work.
Well, guess what you fucking moron. That's not what we agreed upon. You fuckin' retard think you're so smart but you say EVERYTHING on WhatsApp! Including your promises to me. Thank you you fuckin' piece of dog shit because now I have hard evidence and will hand it over to my lawyer to make you pay every god damn cent for all the hours I've spent working on our business. Oh, and I'll take over the webshop and make it a success on my own because I know damn well how to get relevant traffic and thus customers.
You just go get yourself fucked in the ass without lubricant you fuckin' asshole. I have told you you shouldn't fuck with me because I take business very seriously. I even warned you when you were crossing a line again. Well, if you don't listen... You will pay for the consequences. I will be so damn happy to tell you 'I told you so' with a very very big smile on my face. That momemt WILL come, 'partner'.
Fuck you. You will be fucked. Count on that. Fucking asshole.9 -
M: Me
FAC : Fucking annoying colleague
1.
FAC: Hey how did you set up your microservices?
M: I used docke...
FAC: But docker is hard to setup, i want an easier option
2.
FAC: Which services do you have?
M: I have one service for the api, one with redi..
FAC: Redis is not a service
3.
FAC: Do you use AWS API gateway?
M: No, in set up my ow..
FAC: why would you set up your own? I just use the one from AWS.
4.
FAC: How many instances are you have running
M: I have 5 replic...
FAC: 5 replicas? That's why i hate microservices,they are costly
5.
FAC: How did you divide up your app?
M: Since I am starting, its better to run the monolithic and then break it up lat...
FAC: I knew it,you don't actually use microservices
6.
M:(thinking)* Fucker, if you know it well why are you fucking disturbing me?? *2 -
I honestly have no energy to even type this out because this is so draining, but here goes.
I am usually very calm and can keep my composure well, but boy do you push my limits. Do you think my work is so easy that it’s just “a bunch of queries and simple logic”? Well, fine. YOU FUCKING DO IT.. right before I grab you by your fucking neck and shove your face repeatedly into the keyboard. You even have the audacity to give us a project and come the very next fucking day and repeatedly keep asking us “iS iT FiNisHeD yEt?” so much and annoy even the calmest in our team even when we clearly stated that it was going to take us 30 work days to fucking finish it. Do you not know what a working day is? 30 work days is not the same as 30 days you dumbfuck. You have no idea how any of these work and yet you preach your bullshit and waste our fucking time when we could have used that time better to finish our work. THIS IS WHY EVERY SINGLE EMPLOYEE KEEPS LEAVING AND WHY THIS COMPANY HAS A VERY LOW EMPLOYEE RETENTION RATE. You won’t even let me finish my fucking lunch in peace. We have 45 minutes for lunch and since I’ve been eating out for almost the past year (I live alone and don’t usually have time to make food at home because of my hour and a half long commute), a close friend of mine’s mom reached out to and said “Hey, since you’ve been usually getting food from outside, why not join us for lunch?”, so I did and it was the most amazing food ever. Mind you, this was the first time I’ve ever left work myself to have lunch since I joined. I did get 10 minutes late because lunchtime tends to fall around the time where the schools close for the day (no shit) and school traffic is usually insane, and you unsurprisingly decided to make an issue out of a non-issue especially since I’M THE ONLY FUCKING PERSON WORKING IN THE COMPANY and also dock my pay for that. Let me also include the time where our one of the others in the management gave us a quick project that was to be quickly finished while we working on an existing project so we put aside a day just to complete and ship the app and the features and as usual, you decided to make an issue out of a non-issue and decided to shame us publicly and even made (my now former) colleague cry. You’re just a spoiled, selfish, ignorant nit-witted fucking imbecile who has no idea how to even properly run a business. Get fucked in the arse with a cactus. I'm done. I've held on for so long but this is the last straw. I'll be handing my letter of resignation soon. Good luck with running a company without any employees.20 -
A couple of months back I got an interview for a junior android devel position. I do not consider myself a junior devel, bt fuck it they paid 78k a year plus benefits and this is for south texas where it ain't thaaat expensive. So i kept my mouth shut and went with it.
The company was glorious, one of those hipsert marketing companies with cool couches and shit and people doing fuckign whatever all over the place and cool tools and desks.
So the initial interview with the hr dept went amazing, real cool guys and very down to earth. Next was the senior android dev.
This dude.
It was to be a phone interview, with a lil coding test. Fine whatevs. But the moment he called i knew shit was going down hill. Dude sounded dead af. Like he could not stand being himself that day. Asked asshole questions that every developer in Android should know that were frankly quite insulting ("what company develops the Android os" kind of deal) but kept my mouth shut and answered as needed.
Then the coding portion. Given a string, find the first position of the first repeated char, so if I had , fuck i dunno "tetas" then t was the first (and only) char repeated and it should have given out 2.
Legit finished it up in less than 6 mins and only because he was making me explain my entire thought process.
He got angry for some reason. Mind you I speak like a hippie, with a melow town and calm voice all the damned time, got that Texas swag going on as well as any good ol' boy from Texas should right?
Well this dude was not having none of that shit that day.
Dude was all like "ok now....why exactly did you do it this way?"
With a VERY condescending tone. And i explained that at first I normally think about solutions in pseudocode, so I wrote that as well...1 min or less. In python. This is after I still had the Java solution on screen with perfectly clean and working Java. I saif that since Python was as close to pseudocode as it gets that I figured i would just write the "pseudocode" in python and then map it to Java with all the required modifications.
"Welk i did not ask you to write it in java, so i dunno why you would even do that to begin with"
That is one of many asshole remarks. The first when I mentioned that I found React Native good for prototyping complex ideas for FUCKING FUN. Passion motherfucker. Shit so fly I do it for fun. "We don't deal with that here so I am not interested in what you can do with that or how would it help me"
Mofocka plz.
Well going back to the python shit. I explain (calmly) that it was just a way that I had to figure details, to think of different implementations. He continues by saying that it takes valuable company time.
Then he proceeds to tell me that he believes that i cheated since i fi ished the java "problem" too fast.
I told him that simple stuff like that should take even less for any senior java dev and that we could run another example if he wanted.
Bring it puto.
But no.
He then said that he still did not understand the need for Python in my solution. I lost it.
"Look man, getting real tired of your tone, i explained already, it is just a mental process, i do this when comming up with solutions, thinking in theory, not languages, helps me bridge the gap between problem and implementation, the solution works, it is efficient and fast and i can do it in 5 diff ways if you wanted, i offered and you said no. Don't really know what else you want"
"All i am saying, i am not going to hire you if you are going to be writing Python for Android, that is useless to me"
Lost it more.
I do sound different when pissed. So I basically told him that he asked for my reasoning behind and it was given, that not getting it was a you problem.
Sooooo did not get the job. Was relieved really. Can't imagine having a twat like that as a lead devel.19 -
#3 Worst thing I've seen a co-worker do?
A 20-something dev, 'A', back in the early days of twitter+facebook would post all his extracurricular activities (drinking, partying, normal young-buck stuff). The dev mgr, 'J', at the time took offense because he felt 'A' was making the company look bad, so 'A' had a target on his back. Nothing 'A' did was good enough and, for example, 'J' had the source control czars review 'A's code to 'review' (aka = find anything wrong). Not sorting the 'using' statements, and extra line after the closing }, petty things like that. For those curious, orders followed+carried out by+led by 'T' in my previous rant.
As time went on and 'T' finding more and more 'wrong' with A's code, 'J' put A on disciplinary probation. 'A' had 90 days to turn himself around, or else.
A bright spot was 'A' was working on a Delphi -> C# conversion, so a lot of the code would be green-field development and by simply following the "standards", 'A' would be fine...so he thought.
About 2 weeks into the probation, 'A' was called into the J's office and berated because the conversion project was behind schedule, and if he didn't get the project back on track, 'A' wouldn't make it 30 days. I sat behind 'A' and he unloaded on me.
<'A' slams his phone on his desk>
Me: "Whoa...whats up?"
A: "Dude, I fucking hate this place, did you hear what they did?"
<I said no, then I think we spent an hour talking about it>
Me: "That all sucks. Don't worry about the code. Nobody cares what T thinks. Its not even your fault the project is behind, the DBAs are tasked with upgrades and it's not like anyone is waiting on you. It'll get done when it's done. Sounds like a witch hunt, what did you do? Be honest."
A: "Well, um...I kinda called out J, T, and those other assholes on facebook. I was drunk, pissed, and ...well...here we are."
Me: "Geez, what a bunch of whiney snowflakes. Keep your head down and you'll get thru it, or don't. Its not like you couldn't find another job tomorrow."
A: "This is my first job out of college and I don't want to disappoint my dad by quitting. I don't even know what I'm supposed to be doing. All J told me was to get better. What the fuk does that even mean?"
Me: "He didn't give you any goals? Crap, for someone who is a stickler for the rules, that's low, even for J."
Fast forward 2 weeks, I was attending MS TechEd and I was with another dev mgr, R.
R: "Did you hear? We had to let 'A' go today."
Me: "What the hell? Why?"
R: "He couldn't cut it, so we had to let him go."
Me: "Cut what? What did he do, specifically?"
R: "I don't know, 'A' was on probation, I guess he didn't meet the goals."
Me: "You guess? We fire a developer working on a major upgrade and you guess? What were these so-called goals?"
R: "Whoa...you're getting a little fire up. I don't know, maybe not adhering to coding standards, not meeting deadlines?"
Me: "OMG...we fire people for not forming code? Are you serious!?"
R: "Oh...yea...that does sound odd when you put it that way. I wish I'd talk to you before we left on this trip"
Me: "What?! You knew they were firing him *before* we left? How long did you know this was happening?"
R: "Honestly, for a while. 'A' really wasn't a team player."
Me: "That's dirty, the whole thing is dirty. We've done some shitty things to people, but this is low, even for J. The probation process is meant to improve, not be used as a witch hunt. I don't like that you stood around and let it happen. You know better."
R: "Yea, you're right, but doesn't change anything. J wanted to do it while most of us were at the conference in case 'A' caused a scene."
Me: "THAT MAKES IT WORSE! 'A' was blindsided and you knew it. He had no one there that could defend him or anything."
R: "Crap, crap, crap...oh crap...jeez...J had this planned all along...crap....there is nothing I can do no...its too late."
Me: "Yes there is. If 'A' comes to you for a letter of recommendation, you write one. If someone calls for reference, you give him a good one."
R: "Yea..yea...crap...I feel like shit...I need to go back to the room and lie down."
As the sun sets, it rises again. Within a couple of weeks, 'A' had another job at a local university. Within a year, he was the department manager, and now he is a vice president (last time I checked) of a college in Kansas City, MO.10 -
This happens way too FUCKING often:
Random person: Hey, can I have your number so I can text you?
Me: Yeah sure! *gives number*
*A few days later*
Person: Hey you gave me your number to message you but I can't find you on whatsapp???
Me: no indeed....?
Person: Well, then why did you give me your number?!?
Me: you asked if you could TEXT me, I don't have whatsapp.....?
Person: Ohh but I meant whatsapping.... that's like the same
THAT'S NOT THE MOTHERFUCKING SAME!!! TEXTING != WHATSAPPING YOU FUCKING COCKSUCKING MOTHERFUCKING ANNOYING PIECE OF GRRRRRRRRR5 -
At one of my former jobs, I had a four-day-week. I remember once being called on my free Friday by an agitated colleague of mine arguing that I crashed the entire application on the staging environment and I shall fix it that very day.
I refused. It was my free day after all and I had made plans. Yet I told him: OK, I take a look at it in Sunday and see what all the fuzz is all about. Because I honestly could fathom what big issue I could have caused.
On that Sunday, I realized that the feature I implemented worked as expected. And it took me two minutes to realize the problem: It was a minor thing, as it so often is: If the user was not logged in, instead of a user object, null got passed somewhere and boom -- 500 error screen. Some older feature broke due to some of my changes and I never noticed it as while I was developing I was always in a logged in state and I never bothered to test that feature as I assumed it working. Only my boss was not logged in when testing on the stage environment, and so he ran into it.
So what really pushed my buttons was:
It was not a bug. It was a regression.
Why is that distinction important?
My boss tried to guilt me into admitting that I did not deliver quality software. Yet he was the one explicitly forbidding me to write tests for that software. Well, this is what you get then! You pay in the long run by strange bugs, hotfixes, and annoyed developers. I salute you! :/
Yet I did not fix the bug right away. I could have. It would have just taken me just another two minutes again. Yet for once, instead of doing it quickly, I did it right: I, albeit unfamiliar with writing tests, searched for a way to write a test for that case. It came not easy for me as I was not accustomed to writing tests, and the solution I came up with a functional test not that ideal, as it required certain content to be in the database. But in the end, it worked good enough: I had a failing test. And then I made it pass again. That made the whole ordeal worthwhile to me. (Also the realization that that very Sunday, alone in that office, was one of the most productive since a long while really made me reflect my job choice.)
At the following Monday I just entered the office for the stand-up to declare that I fixed the regression and that I won't take responsibility for that crash on the staging environment. If you don't let me write test, don't expect me to test the entire application again and again. I don't want to ensure that the existing software doesn't break. That's what tests are for. Don't try to blame me for not having tests on critical infrastructure. And that's all I did on Monday. I have a policy to not do long hours, and when I do due to an "emergency", I will get my free time back another day. And so I went home that Monday right after the stand-up.
Do I even need to spell it out that I made a requirement for my next job to have a culture that requires testing? I did, and never looked back and I grew a lot as a developer.
I have familiarized myself with both the wonderful world of unit and acceptance testing. And deploying suddenly becomes cheap and easy. Sure, there sometimes are problems. But almost always they are related to infrastructure and not the underlying code base. (And yeah, sometimes you have randomly failing tests, but that's for another rant.)9 -
One day I developed a simple website for a goldsmith who I already new for a year or so.
We discussed everything and agreed on a feature set, price and a deadline when it should be ready. Based on this we signed a contract and I started my work.
Unfortunately at the same time I lost most of my childhood friends. I moved to a new city and started to study computer science, which was awesome on the contrary.
This is where the horror began.
I was totally occupied by the studying, my partner, myself and by the shit of life.
It knocked on my door. The horror decided to pay me a visit.
"Had a look at your calendar recently? Just saying..."
Shit! The deadline came closer and closer everyday and the pile of work undone grew with it. At that point I had to do something. I don't know what it was or how I did it, but somehow I managed to finish the project just in time. I was totally not proud of it, but it featured what was required.
The day before I contacted my client, the horror knocked on my door again. He said:
"You really should have a look at your hard drive."
"Why? everything seems allright."
"Well, then look closer."
"Fuck."
"Right."
Well, there are backups at least, I thought to myself. I'll just recover the last state. That was an annoying thought, but nothing serious. That's just one or two days of w... - Wait, what? Where are my backups? What the actual fuck? Why is the zip file broken? Why doesn't the flash drive work anymore? FUUUCK!!
I was lost. It was a complete nightmare.
Each time my telephone rang the following days, my heart skipped a beat. Finally my client's name appeared on the display. I answered the call, my hands shaking.
"Hey there! I'm calling to discuss the website project with you."
"Well, about that..."
"Yeah, I know you put a huge amount of efford in it so I'm really sorry to say that I on the other hand can't effort the money. Actually I'd like to simply forget about this whole idea."
Seriously? What the fuck just happend? I suddenly noticed a sticky note infront of me reading:
"It was really fun to see you suffer, but I have to go! See ya
- The Horror"
"Hello, are you still there? Do you hear me?", yelled a voice through my phone.
"Uh, yeah. You know, that project was a lot of work and... but you know what? It was actually a pretty fun exercise and I'm doing well over here, so because it's you I'd agree."
I heared a reliefed sigh from the other end of the line.
"Really good! I owe you something! Bye!"
What. The. Fuck.14 -
Wow this one deserves a rant. Where should I even begin? I got a new job for over half a year now doing work in an agency. We're building websites and online shops with Typo3 and Shopware (not my dream, but hey). All fine you might think BUT...
1) I have been working on the BIGGEST project we have all by myself since I started working at this company. No help, nobody cares.
2) If something goes wrong all the shit falls back to me like "wHy DiDnT yoU WoRk MoRE?". Seriously? How should one dev cover a project that's meant for at least two or three.
3) The project was planned four years ago (YES that's a big fat FOUR) and sat there for 3,5 years - nobody gave a fuck. I got into the company and immediately got the sucky shit project to work on.
4) I was promised some time to get familiar with the projects and tech we use and "pick something I like most to get started". Well that never happened.
5) I was also promised not to talk directly to our customers. Well, each week I was bombarded with insults, a shitload of work and nonsense by our customers because (you guessed it) I was obligated to attend meetings.
6) The scheduled time for a meeting was 30 minutes, sometimes they just went on for over two hours. Fml.
7) Project management. It does not exist. The company is just out to get more and more clients, hires more god damn managers and shit and completely neglects that we might need more devs to get all this crap finished. Nope, they don't care. By the way: this is not like a 200 employee company, it's more like 15 which makes it even sadder to have 4 managers and 3 devs.
8) We don't use trello (or anything to keep track of our "progress"), nobody knows the exact scope of the project, because it was planned FOUR FUCKING YEARS AGO.
9) They planned to use 3 months on this project to get it finished (by the way it's not just an online shop, it has a really sophisticated product configurator with like 20 dependencies). Well, we're double over that time period and it is still not finished.
10) FUCK YOU SHOPWARE
11) The clients are super unsatisfied with our service (who would have guessed). They never received official documents from us (that's why nobody knows the scope), nor did they receive the actual screen design of the shop so we just have to make it up on the go. Of course I mean "I" by "we", because appearently it is my job to develop, design and manage this shit show.
12) My boss regularly throws me in front of the bus by randomly joining meetings with my client telling them the complete opposite of things that we discussed internally (he doesn't know anything about this stupid project)
13) FUCK YOU COLLEAGUES, FUCK YOU COMPANY, FUCK YOU SHOPWARE AND FUCK YOU STUPID CUSTOMERS.
14) Oh btw. the salary sucks ass, it's barely a couple of bucks above minimum wage. Don't ask me why I accepted the offer. I guess it was better than nothing in the meantime.
Boy that feels good. I needed that rant. But hey don't get me wrong. I get that dev jobs can be hard and sucky, but this is beyond stupidity that I can bear. I therefore applied for a dev job in research at a university in my dream country. Nice colleagues, interesting projects, good project management. They accepted me, gave me a good offer and I can happily say that in 6-7 weeks my current company can go fuck themselves (nobody knows the 10.000+ lines of code but me). Just light it up and watch it burn!20 -
Aaaah...I just got back from a meeting because of a production data problem caused by an analyst who keeps making mistakes that screw up client data. I wrote a program to automate most of it and everybody initially accused me of having a buggy program, only to find out she wasn't using it, never did.
"Why aren't you using the program then?" was asked. "Oh, well, I just understand my way better," she replies, "When I make a mistake at least I understand why."
Pause....
"Then, um, if you know you're making a mistake, why don't you fix it?"
"Because my process is so manual and labor intensive sometimes it's not worth it to go back and fix it, because I'd have to do everything over again, and you guys are much better at fixing this stuff than I am."
I indicated that everyone is too busy to stop and fix her mistakes, to which she then asks:
"So if you can't fix my mistakes, what am I supposed to do?"8 -
I might have posted this before. But I am going to post it again. Because emojis.
Me: 😁 Software lead I have finished coding the thing.
SL: 😀 Cool, good job. That is going to really help out the analysts.
Software Manager: 😐 hey I noticed you have coded a new thing and pushed it to integration.
Me: 😁 Yes.
SM: 😐 Well how do you know when it's done?
Me: 😑 . . . When you run it and it does the thing?
SM: 😐 Did you write test steps?
Me: 😕 Yeah . . . they're in the issue ticket.
SM: 😐 Yeah but how do you know those are right?
Me: 😕 Because I wrote the thing and the test steps?
SM: 😐 did you put any steps in our acceptance test procedure?
Me: 😕 No.
SM: 😐 why not?
Me: 😧 Because the acceptance test procedure tests requirements. There is no requirement for this functionality.
SM: 😑 Then why did you do it?
Me: 🤔 Because it was an internal request from the analysis team. There is no customer impact here.
SM: 😑 I really think we should write a requirement.
SL: 🤔 But what requirement is he going to attach this to?
SM: 😑 We don't have to attach it to a requirement. We can just test it once and remove it.
Me: 😒 SM, you know we never remove anything from the acceptance test procedure.
SM: 🙂 We do sometimes.
SL: 🤔 When was that I have worked here for twenty years and we have never removed a test from that document.
SM: 😑
SL: 😒
SM: 😑
SL: 😒
Me: 🤐
SM: 😧 I really think there should be an acceptance test written.
SL: 😧 Looks like you're writing an acceptance test.
Me: 😒 Alright as long as y'all're payin'. Shit I was just tryin' to save y'all money.
*acceptance test written and sent to peer review*
Peer: 😐 The requirement tested section doesn't have any requirements spelled out.
Me: 😅 No.
Peer: 🤔 Why?
Me: 😓 Because there is no requirement associated with this test.
Peer: 🤔 Then why are we adding an acceptance test?
Me: 😡 WELL AIN'T THAT A GOOD GOD DAMN QUESTION!?6 -
An intern I was supposed to lead (as an intern) and work with. Which sounded kinda crazy to me, but also fun so I rolled with it. But when I met her I quickly found out she didn't even have a coding editor installed and when I advised one she was "scared of virusses". She had Microsoft Edge in her toolbar, and some picture of a cat as a background. We were given some project by our boss, and a freelance programmer helped us set it up on Trello. Great, lets start! Oke maybe first some R&D, she had to reaeach how to use the Twilio API. After catching her on WhatsApp a few times I realised this wasnt gonna go anywere. After a few weeks of coding and posting a initial project to git I asked her if she could show me the code of the API she made so far..
She told me she was using the quickstart guide (the last 3 FUCKING weeks) which contained some test project with specific use cases.
The one that I did 3 weeks ago that same fucking morning.
AND SHE WAS STILL NOT DONE...
A few days later I asked her about the progress (strangly, I wasn't allowed ti give her another task bcs the freelanc already did) and guess what... She got fking pissed at me
Her: "I will come to you when im done, ok?"
Me: "I just want to see how it is going so far and if you are running into any problems!"
Her: "I dont want to show you right now"
She then goes to my fucking boss to tell him I am bothering her.
And omg... Please dear god please kill me now...
Instead of him saying the she probably didn't do shit. He says to me that the girl thinks im looking down on her and she needs a stress free environment to work in. She will show me when its done. ITS A FUCKING QUICKSTART GUIDE YOU DUMB BITCH.
He then procceeded to whine to me about the email template (another project I do at the same time) which didn't look perfect in all of his clients.
Dont they understand that I am not a frontend developer? Can you stop please? I know nothing about email templates, I told you this!!!
Really... the whole fucking internship the only thing the girl did was ask people if they want more tea. Then she starts cleaning the windows, talk to people for an hour, or clean everyone's dask.
all this while I already made 50% of the fucking product and she just finished the quickstart tutorial 😭. Truly 2 months wasted, and the worse thing is I didn't get any apprication. They constantly blamed me and whined at me. Sometimes for being 3 minutes late, the other for smoking too much, or because I drink to much coffee, or that I dont eat healthy. They even forced me to play Ping Pong. While im just trying to do my job. One of the worst things they got mad at me for if when my laptop got hacked bcs it was infected with some virus. He had remote access and bought 5 iPhones 6's with my paypal while I was on break. I had to go home and quickly reset all my passwords and make sure the iPhones wouldnt get delivered. strange this was, this laptop I only used at the company. So it must have been software I had to download there. Probably phpstorm (torrent). Bcs nobody would give me a license. And the freelancer said I * have to *.
the monday after I still had to reinstall windows so I called them and said I would be late. when I came they were so disrepectfull and didn't understand anything. It went a little like this:
Boss: why u late?
Me: had to reinstall my laptop, sorry.
Boss: why didnt you do this in your own time?
Me: well, I didn't have any time.
Boss: cant you do this in the weekend or something? Because now we have to pay you several hours bcs you downloaded something at home.
Me: I am only using this laptop for work so thats not possible.
Boss: how can that even be possible? You are not doing anything at home with your laptop? Is that why you never do anything at home?
Me: uhm, I have desktop computer you know. Its much faster. And I also need to rest sometimes. Areeb (freelancer) told me to torrent the software. He gave me the link. 2 days later this happends
Boss: Ahh okeee I see.. Well dont let it happen again.
After that nobody at the compamy trusted me with anything computer related. Yes it was my own fault I downloaded a virus but it can happen to anyone. After that I never used Windows again btw, also no more auto login apps.8 -
"Hey nephew, why doesn't the FB app work. It shows blank white boxes?"
- It can't connect or something? (I stopped using the FB app since 2013.)
"What is this safe mode that appeared on my phone?!"
- I don't know. I don't hack my smartphone that much. Well, I actually do have a customised ROM. But stop! I'm pecking my keyboard most of the time.
"Which of my files should I delete?"
- Am I supposed to know?
"Where did my Microsoft Word Doc1.docx go?"
- It lets you choose the location before you hit save.
"What is 1MB?"
- Search these concepts on Google. (some of us did not have access to the Internet when we learned to do basic computer operations as curious kids.)
"What should I search?"
- ...
"My computer doesn't work.. My phone has a virus. Do you think this PC they are selling me has a good spec? Is this Video Card and RAM good?"
- I'm a programmer. I write code. I think algorithmically and solve programming problems efficiently. I analyse concepts such as abstraction, algorithms, data structures, encapsulation, resource management, security, software engineering, and web development. No, I will not fix your PC.7 -
So I've been looking for a Linux sysadmin job for a while now. I get a lot of rejections daily and I don't mind that because they can give me feedback as for what I am doing wrong. But do you know what really FUCKING grinds my FUCKING gears?
BEING REJECTED BASED ON LEVEL OF EDUCATION/NOT HAVING CERTIFICATIONS FOR CERTAIN STUFF. Yes, I get that you can't blindly hire anyone and that you have to filter people out but at least LOOK AT THEIR FUCKING SKILLSET.
I did MBO level (the highest sub level though) as study which is considered to be the lowest education level in my country. lowest education level meaning that it's mostly focused on learning through doing things rather than just learning theory.
Why the actual FUCK is that, for some fucking reason, supposed to be a 'lower level' than HBO or Uni? (low to high in my country: MBO, HBO, Uni). Just because I learn better by doing shit instead of solely focusing on the theory and not doing much else does NOT FUCKING MEAN THAT I AM DUMBER OR LESS EDUCATED ON A SUBJECT.
So in the last couple of months, I've literally had rejections with reasons like
- 'Sorry but we require HBO level as people with this level can analyze stuff better in general which is required for this job.'. - Well then go fuck yourself. Just because I have a lower level of education doesn't FUCKING mean that I can't analyze shit at a 'lower level' than people who've done HBO.
- 'You don't seem to have a certificate for linux server management so it's a no go, sorry!' - Kindly go FUCK yourself. Give me a couple of barebones Debian servers and let me install a whole setup including load balancers, proxies if fucking neccesary, firewalls, web servers, FUCKING Samba servers, YOU FUCKING NAME IT. YES, I CAN DO THAT BUT SOLELY BECAUSE I DON'T HAVE THAT FUCKING CERTIFICATE APPEARANTLY MEANS THAT I AM TOO INCOMPETENT TO DO THAT?! Yes. I get that you have to filter shit but GUESS WHAT. IT'S RIGHT THERE IN MY FUCKING RESUME.
- 'Sorry but due to this role being related to cyber security, we can't hire anyone lower than HBO.' - OH SO YOUR LEVEL OF EDUCATION DEFINES HOW GOOD YOU ARE/CAN BE AT CYBER SECURITY RELATED STUFF? ARE YOU MOTHERFUCKING RETARDED? I HAVE BEEN DOING SHIT RELATED TO CYBER SECURITY SINCE I WAS 14-15 FUCKiNG YEARS OLD. I AM FAMILIAR WITH LOADS OF TOOLS/HACKING TECHNIQUES/PENTESTING/DEFENSIVE/OFFENSIVE SECURITY AND SO ON AND YOU ARE TELLING ME THAT I NEED A HIGHER LEVEL OF FUCKING EDUCATION?!?!? GO FUCKING FUCK YOURSELF.
And I can go on like this for a while. I wish some companies I come across would actually look at skills instead of (only) study levels and certifications. Those other companies can go FUCK THEMSELVES.39 -
Went blank when interviewer asked me do I know KITT. I knew that he didn't mean Knight Rider, but I could not think of anything sensible in the few seconds I had time to answer the question so I answered NO. Interviewer said that it is a basic requirement for the job and it seemed that I lacked the basic skill needed for the job.
Needless to say I didn't get the job. Later that day as I was telling my friends about the interview they seemed really confused....
"... but you know GIT very well. You use it on a daily basis. Why did you answer NO ?"
Damn, blew my interview on pronounciation issue :/9 -
TL;DR: If you're an Android user, do yourself a favour and check out https://simplemobiletools.com/ . You're welcome.
Dear diary, today was a good day.
A small part of my faith in humanity was recovered after I found about Tibor Kaputa.
Apparently, this guy - like many of us - was fed up with the bloat, bugs, bullshit and 'features' of many of the stock Android apps that come preinstalled on most phones. And so, he decided to make his own.
Unlike most of us however, he actually pulled through. And then he made them open source.
No bullshit permission requirements.
No ads or tracking.
Custom themes.
And no, not just 'toggle white/dark mode', I'm talking 'pick your own color scheme', both within the app and for the app icon (!).
And then sync your colour scheme across the entire suite of apps (!!).
Simple UI, with a lot of customizable settings.
And if you get them from f-droid, it's all completely free as in BEER too!
I've spent a lot of time in the last year trying to find software that does what it's supposed to do well, without trying to pull any sneaky bullshit in the background or annoy me with crap that I don't care about in a miserable attempt to show off its useless features.
I'm not a fan of Medium myself either, but the author's article about how his suite of apps was born really resonated with me. If you care about privacy, open source software, and doing things right, you should really give it a read: https://medium.com/@tibbi/...
I'm particularly a fan of the Gallery, the File Manager, and the Music player apps, and the others don't look half bad either.11 -
Our website once had it’s config file (“old” .cgi app) open and available if you knew the file name. It was ‘obfuscated’ with the file name “Name of the cgi executable”.txt. So browsing, browsing.cgi, config file was browsing.txt.
After discovering the sql server admin password in plain text and reporting it to the VP, he called a meeting.
VP: “I have a report that you are storing the server admin password in plain text.”
WebMgr: “No, that is not correct.”
Me: “Um, yes it is, or we wouldn’t be here.”
WebMgr: “It’s not a network server administrator, it’s SQL Server’s SA account. Completely secure since that login has no access to the network.”
<VP looks over at me>
VP: “Oh..I was not told *that* detail.”
Me: “Um, that doesn’t matter, we shouldn’t have any login password in plain text, anywhere. Besides, the SA account has full access to the entire database. Someone could drop tables, get customer data, even access credit card data.”
WebMgr: “You are blowing all this out of proportion. There is no way anyone could do that.”
Me: “Uh, two weeks ago I discovered the catalog page was sending raw SQL from javascript. All anyone had to do was inject a semicolon and add whatever they wanted.”
WebMgr: “Who would do that? They would have to know a lot about our systems in order to do any real damage.”
VP: “Yes, it would have to be someone in our department looking to do some damage.”
<both the VP and WebMgr look at me>
Me: “Open your browser and search on SQL Injection.”
<VP searches on SQL Injection..few seconds pass>
VP: “Oh my, this is disturbing. I did not know SQL injection was such a problem. I want all SQL removed from javascript and passwords removed from the text files.”
WebMgr: “Our team is already removing the SQL, but our apps need to read the SQL server login and password from a config file. I don’t know why this is such a big deal. The file is read-only and protected by IIS. You can’t even read it from a browser.”
VP: “Well, if it’s secured, I suppose it is OK.”
Me: “Open your browser and navigate to … browse.txt”
VP: “Oh my, there it is.”
WebMgr: “You can only see it because your laptop had administrative privileges. Anyone outside our network cannot access the file.”
VP: “OK, that makes sense. As long as IIS is securing the file …”
Me: “No..no..no.. I can’t believe this. The screen shot I sent yesterday was from my home laptop showing the file is publicly available.”
WebMgr: “But you are probably an admin on the laptop.”
<couple of awkward seconds of silence…then the light comes on>
VP: “OK, I’m stopping this meeting. I want all admin users and passwords removed from the site by the end of the day.”
Took a little longer than a day, but after reviewing what the web team changed:
- They did remove the SQL Server SA account, but replaced it with another account with full admin privileges.
- Replaced the “App Name”.txt with centrally located config file at C:\Inetpub\wwwroot\config.txt (hard-coded in the app)
When I brought this up again with my manager..
Mgr: “Yea, I know, it sucks. WebMgr showed the VP the config file was not accessible by the web site and it wasn’t using the SA password. He was satisfied by that. Web site is looking to beat projections again by 15%, so WebMgr told the other VPs that another disruption from a developer could jeopardize the quarterly numbers. I’d keep my head down for a while.”8 -
It seems like every other day I run into some post/tweet/article about people whining about having the imposter syndrome. It seems like no other profession (except maybe acting) is filled with people like this.
Well lemme answer that question for you lot.
YES YOU ARE A BLOODY IMPOSTER.
There. I said it. BUT.
Know that you're already a step up from those clowns that talk a lot but say nothing of substance.
You're better than the rockstar dev that "understands" the entire codebase because s/he is the freaking moron that created that convoluted nonsensical pile of shit in the first place.
You're better than that person who thinks knowing nothing is fine. It's just a job and a pay cheque.
The main question is, what the flying fuck are you going to do about being an imposter? Whine about it on twtr/fb/medium? HOW ABOUT YOU GO LEARN SOMETHING BEYOND FRAMEWORKS OR MAKING DUMB CRUD WEBSITES WITH COLOR CHANGING BUTTONS.
Computers are hard. Did you expect to spend 1 year studying random things and waltz into the field as a fucking expert? FUCK YOU. How about you let a "doctor" who taught himself medicine for 1 year do your open heart surgery?
Learn how a godamn computer actually works. Do you expect your doctors and surgeons to be ignorant of how the body works? If you aspire to be a professional WHY THE FUCK DO YOU STAY AT THE SURFACE.
Go learn about Compilers, complete projects with low level languages like C / Rust (protip: stay away from C++, Java doesn't count), read up on CPU architecture, to name a few topics.
Then, after learning how your computers work, you can start learning functional programming and appreciate the tradeoffs it makes. Or go learn AI/ML/DS. But preferably not before.
Basically, it's fine if you were never formally taught. Get yourself schooled, quit bitching, and be patient. It's ok to be stupid, but it's not ok to stay stupid forever.
/rant14 -
I've had 3 interviews with the same company. The first two interviews went pretty well, they looked interested, on the third they tell me "your CV says you are not graduated yet, we can't hire you now".
SO WHY THE FUCK DID YOU HAD TO WASTE MY TIME?
You've had my CV before the first interview, why the hell didn't you read that I am still a student? Is the first thing it's written on it! Stupid fuckers.5 -
Dev: “Ughh..look at this –bleep- code! When I execute the service call, it returns null, but the service received a database error.”
Me: “Yea, that service was written during a time when the mentality was ‘Why return a service error if the client can’t do anything about it?’”
Dev: “I would say that’s a misunderstanding of that philosophy.”
Me: “I would say it’s a perfectly executed example of a deeply flawed philosophy.”
Dev: “No, the service should just return something that tells the client the operation failed.”
Me: “They did. It was supposed to return a valid result, and the developer indicated a null response means the operation failed. How you deal with the null response is up to you.”
Dev: “That is stupid. How am I supposed to know a null response means the operation failed?”
Me: “OK, how did you know the operation failed?”
Dev: “I had to look at the service error logs.”
Me: “Bingo.”
Dev: “This whole service is just a –bleep-ing mess. There are so many things that can go wrong and the only thing the service returns is null when the service raises an exception.”
Me: “OK, what should the service return?”
Dev: ”I don’t know. Error 500 would be nice.”
Me: “Would you know what to do with error 500?”
Dev: ”Yea, I would look at the error log”
Me: “Just like you did when the service returned null?”
<couple of seconds of silence>
Dev: “I don’t know, it’s a –bleep-ing mess.”
Me: “You’re in the code, change it.”
Dev: “Ooohhh no, not me. The whole thing will have to be re-written. It should have been done correctly the first time. If we had time to do code reviews, I would have caught this –bleep- before the service was deployed.”
Me: “Um, you did.”
<a shocked look from Dev>
Dev: “What…no, I’ve never seen this code.”
Me: “I sat next to Chuck when you were telling him he needed to change the service to return null if an exception was raised. I remember you telling him specifically to pop-up an error dialog ‘Service request failed’ to the user when the service returned null.”
Dev: “I don’t remember any of that.”
Me: “Well, Chuck did. He even put it in the check-in comments. See…”
<check in comments stated Dev’s code review and dictated the service return null on exceptions>
Dev: “Hmm…I guess I did. –bleep- are you a –bleep-ing elephant? You –bleep-ing remember everything.”
<what I wanted to say>
No, I don’t remember everything, but I remember all the drive-by <bleep>-ed up coding philosophies you tried to push to the interns and we’re now having all kinds of problems I spend waaaaay too much time fixing.
<what I said, and lied a little bit>
Me: “No, I was helping Nancy last week troubleshoot the client application last week with the pop-up error. Since the service returned a null, she didn’t know where to begin to look for the actual error.”
Dev: “Oh.”1 -
Buddy from dept I was in 4 years ago: Check your email.
Me: OK
10 mins later
Buddy: Can you join a webex now?
Me: No
Buddy: OK, I'll forward the details, join when you can.
Me: Could you give me a little context?
Buddy: You helped them pull a cert off a USB stick in Switzerland last year (I'm in US).
Me: Don't think I did.
When I get a chance to read email chain, half of it is in German (I don't read it). Have not idea what this is about, but there seems to be a newer one that says it was resolved.
Me to Buddy: Looks like it was resolved.
Buddy: Yes, but they're still mad at you.
Me: Why?
Buddy: Because you wrote that app and it's hard to update the certs.
Me: I wrote that app as a favor, the dev they hired spent 6 months rewriting 3 SQL queries before being fired.
Buddy: LOL, well I guess they don't like the cert part.
Me: OK, but when I turned it over to them it didn't have a cert at all, I have no idea what the feature is.
Buddy: They said you help them last year.
Me: I didn't.
Buddy: Well they still think it's all your fault.4 -
So as quite some people know on here, I am strongly against closed source software and have a very strong distrust in it as well.
So next to some principles (and believes etc etc etc) there is one specifc 'event' which triggered the distrust in CSS (No not Cascading Style sheet, I mean Closed Source Software :P). So hereby the story about what happened.
I think it was about 5 years ago when a guy joined my programming class (I wasn't in uni although I studied but for the sake of clarity, lets just call it uni for now (also, that makes me feel smarter so why the fuck not!)) in uni. He knew a shitload about programming for his age but he was convinced that he was always right. (that aside)
Anyways, at some point we had to work in groups on this project (groups for specific tasks) and he chose (he loved it, we hated it, he had the final say) Trello for 'project management'. He gave everyone (I was running Windows for a little bit at that moment because the project was in C# and the Snowden leaks had not arrived yet so I was not extremely uncomfortable with using Windows, just a lot) this addon program thingy he created for Trello which would make usage easier. I asked if it was open source, he replied with 'No, because this is my project.' and although I did understand that entirely, I didn't feel comfy using it because of it's closed source nature. Everyone declared me paranoid and he was annoyed as hell but I just kept refusing to use it and just used the web interface.
*skips to 2 years later*
I met that guy again at the train station at a random day! Had the usual 'how are you and what's up after a few years' talk with him and then he told me something that changed my view on closed source software for most probably the rest of my life.
"Hey by the way, do you remember that project of a few years back where you didn't want to use my software because of your 'closed-sourceness paranoia'? I just wanted to say that I actually had some kind of backdooring feature build in which (I am not going to say what) allowed me to (although I didn't use it) look at/do certain things with the 'infected' computers. I really wanted to say that I find it funny how you, the only one who didn't give in to my/the peer pressure, were the only one who wasn't affected by my 'backdoor' at that moment! Also your standards towards the use of closed source software probably played a big part probably. I find that pretty cool actually!"
Although I cannot confirm what he said, he was exactly the type of guy who would do this IMO (and not only IMO I think).
So yeah, that's one of the reasons AND the story behind a big part of why I don't trust closed source software :).5 -
My code review nightmare part 3
Performed a review on/against a workplace 'nemesis'. I didn't follow the department standards document (cause I could care less about spacing, sorted usings, etc) and identified over 80 bugs, logic errors, n+1 patterns, memory leaks (yes, even in .net devs can cause em'), and general bad behavior (ex.'eating' exceptions that should be handled or at least logged)
Because 'Jeff' was considered a golden child (that's another long TL;DR), his boss and others took a major offense and demanded I justify my review, item by item.
About 2 hours into the meeting, our department mgr realized embarrassing Jeff any further wasn't doing anyone any good and decided to take matters into his own hands. Thinking 'well, its about time he did his job', I go back to my desk. About an hour later..
Mgr: "I need you in the conference room, RIGHT NOW!"
<oh crap>
Mgr: "I spoke to Jeff and I think I know what the problem is. Did you ever train him on any of the problems you identified in the review?"
Me: "Um, no. Why would I?"
Mgr: "Ha!..I was right. So lets agree the problems are partially your fault, OK?"
Me: "Finding the bugs in his code is somehow my fault?"
Mgr: "Yes! For example, the n+1 problem in using the WCF service, you never trained him on how to use the service. You wrote the service, correct?"
Me: "Yes, but it's not my job to teach him how to write C#. I documented the process and have examples in the document to avoid n+1. All he had to do was copy/paste."
Mgr: "But you never sat with Jeff and talked to him like a human being? You sit over there in your silo and are oblivious to the problems you cause. This ends today!"
Me: "What the...I have no idea what you are talking about. What in the world did Jeff tell you?"
Mgr: "He told me enough and I'm putting an end to it. I want a compressive training class developed on how to use your service. I'll give you a month to get your act together and properly train these developers."
3 days later, I submit the power-point presentation and accompanying docs. It was only one WCF with a handful of methods. Mgr approved the training, etc..etc. execute the 'training', and Jeff submits a code review a couple of weeks later. From over 80 issues to around 50. The poop hits the fan again.
Mgr: "What's your problem? When are you going to take your responsibility seriously?"
Me: "Its pretty clear I don't have the problem. All the review items were also verified by other devs. Its not me trying to be an asshole."
Mgr: "Enough with the excuses. If you think you can do a better job *you* make the code changes and submit them for Jeff for review. No More Excuses!"
Couple of days later, I make the changes, submit them for review, and Jeff really couldn't say too much other than "I don't see this as an improvement"
TL;DR, I had been tracking the errors generated by the site due to the bugs prior to my changes. After deployment, # of errors went from thousands per hour to maybe hundreds per day (that's another story) and the site saw significant performance increases, fewer customer complaints, etc..etc.
At a company event, the department VP hands out special recognition awards:
VP: "This award is especially well earned. Not only does this individual exemplify the company's focus on teamwork, he also went above and beyond the call of duty to serve our customers. Jeff, come on up and get this well deserved award."18 -
Overheard a phone call between the Senior Network Engineer and a contracted Printer-company at 9am this morning. Photocopier was giving a 'functional error' message on-screen and not printing;
N.E:
I logged this call last
Thursday afternoon. Thats 1.5 days of the photocopier not working on our busiest site! Where's the engineer??
.... yes, that's the error message.
Yes, i can log into it, you should have the IP address from the call.
Yes, it's obviously pinging too.
Yes.... we've power-cycled the printer multiple times...
yes, tried that too...
yes, I've unplugged the network cable as well... left it for 15 minutes.
... sorry. What?
What did you say?
Are you f***ing kidding me?
Would you also like me to rub the side of the f***ing machine, and say a prayer while I'm at it??
*takes a deep breath*
Fine, I'll do that but when it doesn't work, i want someone out on the site before lunchtime today!
*slams phone down angrily*
N.E to me as he stomps out of the office;
He wants me to get the user to unplug the network cable and do a power cycle. How the f**k is that going to help? Idiots! Don't know why we have a contract with them, i could do a better job!!!
*comes back into office 5 minutes later*
Me: did it fix it?
NE: yeah. Damn.
*leaves room again to make apologetic phonecall*2 -
I really fucking hate when people or companies do shit like this..
Apparently Google is changing the salad emoji, which is a bowl that contains lettuce, tomato, egg, onion and stuff like that, to the same, but without the egg.
Why you may ask?
Well.. they did it to "make it a more inclusive vegan salad".
ITS JUST SOME WHITE PIXELS FOR FUCKS SAKE. How would any vegan, besides the crazy ones, be upset about a moist egg in their crisp salad?
I cant even.. im out of words.. fuck.
Additionally, the news page i read it on have been so kind to host a poll of what people think about it, whether its a good idea or not.
Ill let the image speak for itself, if you really need a translation, dont use google translate, ask in the comments.42 -
Dev: Hey that internal audit you asked me to perform didn’t go so well
Manager: It has too! I’ll get in a lot of trouble if it doesn’t pass.
Dev: Ok well it’s a lot of work to get it to a passing state, we have to dedicate a lot of resources to fix all these findings.
Manager: We don’t have any spare resources, they are all working on new projects! Why did you have to find things??
Dev: ….It’s a lot of hard to miss stuff, like missing signatures on security clearance forms
Manager: Ok can’t you just say that everything is all good? They’ll probably not double check.
Dev: I’m not really comfortable with that…Look all of these findings are all just from one member of the team consistently not doing their job, can’t you just address that with him and I can make a note on the audit that issues were found but corrective action was made? That’s the whole point of audits.
Manager: You don’t get it, if anything is found on the audit I’ll look bad. We have to cover this up. Plus that’s a really good friend of mine! I can’t do that to him. Ok you know what? You are obviously not the right person for this task, I’ll get someone else to do it. Go back to your regular work, I’m never assigning you audits again.8 -
Always the same story:
Marketing: hey I'm gonna do a demo to a customer. They were asking for feature XYZ. That's ready on thr staging server right? Do you think I could use the staging server for the demo?
Devs: well feature XYZ is not 100% done. Basically just feature X is done, and it still has a few bugs. The deadline ain't for another month, since we gotta finish ABC first. I guess you could use the staging, but it has a lot of bugs.
Marketing: perfect!
*after presentation*
Marketing: the staging had so many bugs! Why didn't you tell me?! It was so embarrassing showing it to new customers! Anyway, they loved the new feature. We need it to be ready ASAP.
Devs: What?! That's gonna mess up with our schedule. You know what? Fine, but feature ABC will have to wait another month.
Marketing: Well, it'd be ideal if we could do both...
Devs: Pay for more devs or dor extra hours.
Marketing: Just do XYZ. It's a pity that you'll have to push back ABC but it's fine, XYZ is more important.
(I might ask, if it was so important, why didn't you notice so in the meeting where we had decided that ABC would be prioritized?)
*tons of working hours later*
Devs: There, we finished XYZ.
Marketing: Yay! Wow, this month we'll have two major features done: ABC and XYZ!
Devs: No, ABC is not done yet.
Marketing: What? But the deadline was this week.
Devs: It was, but then you decided to prioritize XYZ and we said we had to push back ABC to get XYZ ready, and you agreed.
Marketing: Did we? Fine. But do it quick.
Marketing and their mood swings.6 -
Guy I work with: Hey can I borrow you for a minute
Me: sure. What do you need?
Him: so this is a project me an the other dev worked on
Me thinking: Well I know he did it all and sent you the project so don't tell me you worked on it
Him: so we use it to do this and this and send an email to this new account I made because (2 minute explanation)
Me thinking: I don't care. Just tell me what your issue is! I already know what it is and does from what you told me the last time when you showed me. Which took an hour of my time.
Him: so he sent me this code which is called <Descriptive name> and in the method we have variables call <descriptive name> and it returns a <variable name>
Me thinking: You mother fucker! I don't give a shit what your method is named, what it the variable names are, and you don't need to read through every line of code to me! Just from the descriptive name you just said I know what it does! What the fuck is your issue!?
Him: we also have these other methods. This one is called <Descriptive name> which does...
Me: are you fucking seriously going to read me your code line by line and tell me what you named your variables AGAIN!?
Him: and we named this one <descriptive name>
Me: you mother fucker...
Him: and it calls this stored procedure. (Literally opens the stored procedure and shows me) and it is called...which has parameters called... And it is a select query that inserts
45 minutes later after he finishes explaining all 3 pages of his code and his 5 stored procedures that the other dev wrote...
Him: So anyway, back to this method. I need to know where to put this method. The other dev said to put it in this file, but where do you think I should put it in here? Should I place it after this last one or before it?
Me thinking: You fucking wasted my fucking time just to ask where to place your mother fucking method that the other dev sent to you in a project with only 3 files, all less than 500 lines of code with comments and regions that actually tell you what you should put there and 5 small stored procedures that were not even relevant to your issue! Why the fuck did you need to treat me as a rubber ducky which would fly away if you did have one because you didn't have an issue, you just didn't know where to put your fucking code! FUCK YOUR METHOD!
Me: Where ever you want
Him: Well I think it won't work if I placed it before this method.
I walked away after that. What a waste of time and an insult to my skills and really unchallenging. He's been coding for years and still can't understand anything code related. I'm tired if helping him. Every time he needs something he always has to read through and explain his shit just to ask me things like this. One time he asked me what to name his variable and another his project. More recently he asked why he couldn't get his project he found online to work. The error clearly stated he needed to use c# 7. His initial solution was to change his sql connection string. 😑
He should just go back to setting up computers and fixing printers. At least then he would never be in the office to bug me or the other dev with things like this.7 -
My new glasses are coming soon :)
Now I won't be as blind as a blindfolded grandmother inside a dark cave at night!
Everytime I code, my nose practically touches the screen, because even my mom's old glasses don't really help.
I can barley use Devrantron because of my blindness, but at least I can see well on mobile.
If you are wondering how my old ones broke, well, my little sister sat on them. That little demon, I love her, but she's pure evil.
Oh, and she did it on purpose btw. I asked her why and she said she wanted to know how it feels like to sit on glasses. She's not crazy, she's 6 years old lol.64 -
Man, I think we've all gotten way too many of these.
Normally most interactions that I have are through email. Eventually some would try to contact me via phone. These are some:
"Hey! We are calling you from <whatever company name> solutions! (most of them always seem to end on solutions or some shit like that) concerning the Ruby on Rails senior dev opportunity we were talking about via email"
<niceties, how are you doing, similar shit goes here...eventually>
So tell us! how good/comfortable would you say you are with C++?"
Me: I have never done anything serious with c++ and did just use it at school, but because I am not a professional in it I did not list it in my CV, what does it have to do with Rails?
Them: "Oh the applications of this position must be ready to take in additional duties which sometimes happen to be C or C++"
Me: Well that was not anywhere in the offer you sent, it specifically requested a full stack Rails developer that could work with 3 different frontend stacks already and like 4 different databases plus bla bla bla, I did not see c++ anywhere in it. Matter of fact I find it funny, one of the things that I was curious about was the salary, for what you are asking and specifically in the city in which you are asking it for 75k is way too low, you are seriously expecting a senior level rails dev to do all that AND take additional duties with c++? cpp could mean a billion different things"
Them: "well this is a big opportunity that will increase your level to senior position"
Me: the add ALREADY asks for a senior position, why are you making it sound that I will get build towards that level if you are already off the bat asking for seniors only to begin with?
Them: You are not getting it, it is an opportunity to grow into a senior, applicants right now are junior to mid-level
ME: You are all not making any sense, please don't contact me again.
=======
Them: We are looking for someone with 15 years experience with Swift development for mobile and web
Me: What is up with your people not making these requirements in paper? if I knew from the beginning that you people think that Swift is 15 years old I would have never agreed to this "interview"
Them: If you are not interested in that then might we offer this one for someone with 10 years experience as a full stack TypeScript developer.
Me: No, again, check your dates, this is insulting.
===
* For another Rails position
Them: How good are you with Ruby on Rails in terms of Python?
Me: excuse me? Python has nothing to do with Ruby on Rails.
Her (recruiter was a woman) * with a tone of superiority: I have it here that Python is the primary technology that accompanies Rails development.
Me (thinking this was a joke) : What do you think the RUBY part of Ruby on Rails is for? and what does "accompanies Rails development" even means?
Her: Well if you are not interested in using Rails with Python then maybe you can tell us about your experience in using Javascript as the main scripting platform for Rails.
Me: This is a joke, goodbye.
====
To be fair this was years ago when I still didn't know better and test the recruiters during the email part of being contacted. Now a days I feel sorry for everyone since I just say no without even bothering. This is a meme all on itself which no one has ever bothered to review and correct in years for now. I don't know why recruiters don't google themselves to see what people think of their "profession" in order to become better.
I've even had the Java/Javascript stupidity thrown at me by a local company. For that one it was someone from their very same HR department doing the rectuiter, their shop foreman was a friend of the family, did him the service of calling him to let him know that his HR was never going to land the kind of developer they were looking for with the retarded questions they had and sent him a detailed email concerning the correct information they needed for their JAVAscript job which they kept confusing with Java (for some reason in the context of Spring, they literally wanted nothing with Spring, they wanted some junior to do animations and shit like that on their company's website, which was in php, Java was nowhere in this equation)
I think people in web development get the short end of the stick when it comes to retarded recruiters more than anywhere else.3 -
I got arrested multiple times under acts of cyber crimes...
Yeah, so what if I did? Why is it a problem that I take down CP sites? "Because it's partaking in cyber warfare." Well then the police and the Federal government should execute their job keeping such out of the web space. Now, whenever I find a job, I have to inform due to the judge's final document. And not just that now when I am required to talk to a police officer who has seen my record all they can reckon is to escalate it.
What fantastic horse crap! You get arrested for tracking down child molesters and taking them off the web exclusively...
Some say I'm a social justice warrior, only I don't think that I am. I reckon I am merely an over eccentric programmer who desires to see the real criminals get sent to jail.28 -
I'm going for longest rant. TL:DR; version here:
http://pastebin.com/0Bp4jX9y
then:
http://pastebin.com/FfUiTzsh
Twat Client,
As per our conversation, here is an invoice for the work you requested on behalf of U.S. Bloom. I realize that you ended up going with another designer, but you did request samples of what my take on the logo design would be. The following line item is indicative of 1 hour of graphic design consultation as per your request via Skype.
As I recall, you mentioned that this is not how Upwork "works" but considering it was you who requested that I converse with you via Skype instead of via the Upwork messenger, and since there were no clear instructions on how to proceed with Upwork after our initial consultation, It is assumed that you were foregoing Upwork altogether to work with me directly, thus the invoice from me directly for my time involved in the project. I would have reached out to you via Skype, but it seems that you may have severed our connection there.
After spending a little time researching your company, I could not find current information for Basic Media Marketing, but I was able to reach out to your former partner Not A. Twat, who was more than helpful and suggested that he would encourage you to pay for the services rendered.
It is discouraging that you asked for my help and I delivered, but when I ask for compensation in return for my skills, you refused to pay and have now taken your site offline and removed me as a contact from Skype.
{[CLIENT of CLIENT]},
I am sorry that I have bothered you with this email. I copied you on it merely for transparency's sake. I am sure that your logo is great and I am sure whatever decision was made is awesome for your decision. I just wanted to make sure that you weren't getting "samples" of other people's work passed off as original work by Twat Media Marketing.
I can't speak for any of the other candidates, but since Twat asked me to conduct work with him via Skype rather than through Upwork, and since he's pretty much a ghost online now, (Site Offline, LinkedIn Removed or Blocked, and now Skype blocked as well) one has to think this was a hit and run to either crowdsource your logo inexpensively or pass off other artist's work as his own. That may not be the case, but from my perspective all signs are pointing to that scenario.
Here is a transcript. Some of his messages have been redacted.
As you can clearly see, requests and edits to the logo were being made from Jon to me, but he thinks it's a joke when I ask about invoicing and tries to pass it off as an interview. Do you see any interview questions in there? There were no questions about how long I have been designing, what are my rates, who have I done work for in the past, or examples of my previous work. There were none because he didn't need them at this point.
He'd already seen my proposal and my Behance.net portfolio as well as my rates on Upwork.com. This was a cut to the chase request for my ideas for your logo. It was not just ideas, but mock designs with criticism and approval awaiting. Not only that, but I only asked for an hour of compensation. After looking at the timestamps on our conversation, you can clearly see that I spent at least 3 hours corresponding with Twat on this project. That's three hours of work I could have spent on an honest paying customer.
I trust that TWATCLIENT will do the right thing. I just wanted you guys to know that I was in it to do the best design I could for you. I didn't know I was in it to waste three hours of my life in an "interview" I wasn't aware I was participating in.
Reply from ClientClient:
Hello Sir,
This message is very confusing?
We do not owe your company any money and have never worked with you before.
Therefore, I am going to disregard that invoice.
Reply from TWATCLIENT's boss via phone:
I have two problems with this. One I don't think your business practices are ethical, especially calling MY client directly and sending them an invoice.
Two why didn't you call or email Jon before copying my client on the email invoice?
Me: Probably because he's purposely avoiding me and I had no way to find him. I only got his email address today and that was from a WHOIS lookup.
Really, you don't think my business practices are ethical? What about slavery? Is that ethical? Is it ethical to pass of my designs to your client for critique, but not pay me for doing them?
... I'LL HAVE TO CALL YOU BACK!
My email follow up:
http://pastebin.com/hMYPGtxV
I got paid. The power of CCing the right combination of people is greater than most things on Earth.14 -
So I'm on stack overflow trying to give back to the community that has helped me so much yanno.
So I see a question and decide to answer it but I'm on my mobile and trying to write a well formatted etc. answer is a bit tricky so instead I thought I would answer it as best I could on the phone so at least the OP would be going in the right direction and then when I got back to my computer, I would expand on the answer.
But before I had a chance (within 10 minutes of answering) some 200k+ rep dickhead decided it was his job to tell me how bad I was for not giving a proper answer and i have enough rep to comment and I should know better.
So I responded to him (my first mistake) and told him that my answer was intended to get him going and most likely he wouldn't need any more help but that I was going to update it when I got back to my computer.
Well he didn't like that and continued to berate me for my unbelievable behavior.
I then said that if he was that upset, then report me, or even better how about he actually answer the question instead of being a fuckwit to others that have tried.
I also said that I thought that SO and development in general was not about being given the answer but by finding it yourself and actually learning something and that sometimes you need to be pushed it the right direction to find the answer which is what I did here.
Well he disagreed with that too and downvoted my answer which by that point had been updated (like I said I would).
I just don't get it, what is wrong with these people and why has SO become such a toxic place?
I want to give back to the community and help others like people have done for me over the years, but then fuckheads like this just ruin it and make you not want to be a part of it anymore.
Then I come here to devRant and everyone is so nice to each other, you can see the respect.10 -
Hey. This code look broken. What should I do?
It isn't broken. It's doing what it's supposed to.
Well, it's hard to follow, but it certainly doesn't look right. And it isn't doing what I expect. Also, why is it calling method(a_class1_or_class2) with a class3?
It isn't hard to follow, and it works just fine. Let me show you. ... huh. looks like it isn't right. and there's a comment here saying the calls aren't clear. but it works just fine. Just copy it over and do it the same way.
I already did that. and it isn't working.
What are you talking about? Of course it works fine. Did you check your code?
------
Really, dude? It doesn't work fine. but, guess what? It works fine* when I change it to call that method with a class2 like it asks for. (Surprise!) But I can't tell him that. Nope. Bossmang get offended. Still won't admit I was right about anything, either.
Ahh... the continual joy of working with (and for) trash.
* well, more fine; the rest of the feature is still wrong. but nope, i'm not allowed to fix it. because why would they want anything to work properly? Already-accepted wrong behavior is good enough. Can't clean up the code, either, because that "muddies the waters." Bitch, I couldn't see the bottom of this sewer if it was half an inch deep! Which is more important: the last contributor entry beside the code, or that code being readable and maintainable? or it, you know, working?
doot doot.
need to scoot.7 -
Last Friday company-wide call consisted of the sales CEO bossman, the remote contractor dev, and myself. The only topic of discussion was CTO-bashing (bossman's favorite). Neither person had much of anything to say about their week, and they didn't want to hear my rather-lengthy summary either (I did a lot). All they wanted to do was bash the CTO (API Guy).
The CEO asked how many hours I had worked, and seemed annoyed when I said less than 40. Well screw you. Monday was Christmas, and Sunday was Encroaching Estranged Asshole Day. (Earlier rant)
I've been spending most of my time trying to learn the steaming mountain of rancid hippo shit that API Guy squeezed out, since he's leaving forever in 10 days. Sure, CEO bossman says he'll still be around to answer questions, but even with him right next to me in the office he's less than useful. After he's gone and finally feeling free of this farce? It'll be worth fuck-all.
So bossman is mad at me for both not working enough over Christmas, and not pumping out features at a frantic pace despite multiple explanations of why this is a bad idea. And he didn't care about what work I actually did do.
My every interaction with him makes me angry. Whenever I -- or anyone else -- does something he doesn't approve of, seemingly no matter the reasoning, he makes it out to be a failure on their part, and like he can't trust them as much now.
Well I'm sorry we're trying to make sure our websocket works perfectly before putting it in the hands of our customers who rely on it for cash processing.
I'm sorry I'm trying to recall printers that aren't configured properly, which also prevent customers from using our goddamn service they're paying for.
I'm sorry I'm trying to learn how everything works while I still have someone to talk to and ask questions of.
I'm sorry I'm preparing for the day I have to take over and have you breathing down my neck. Once API Guy's gone I'll be responsible for everything, and you'll be yelling at me and having a @Root bashing session instead if I don't know how to fix everything right away.
But no. All you care about is that I talk to you about what's going in so you can micromanage development despite having zero fucking understanding of goddamn anything. All you ever fucking want is the next shiny feature you can push to make more sales / keep your current contacts happy. Doesn't fking matter if it makes development awful later; that's tomorrow's problem. And yet you have the gall to bash API Guy over and over and over again for the codebase being a mess? Sure he's a terrible programmer, but been putting up with this exact same shit for five years. No wonder it's a mountain of rancid hippo shit. That's as much your fault as his, asshole.
I'm so sorry you "have serious concerns" about me. I don't want to put up with your shit either.
Fuck off and die.22 -
Hello everyone, this is my first time here so hi! I want to tell you all a story about my current situation.
At 18 while in the military I was able to get my first computer, it was a small hp pavilion laptop with windows 7. The system would crash constantly, even though I would only use it for googling stuff and using fb to talk to people. 5 months after I got it and continuously hated it decided to find out why and who could I blame (other than myself) for the system making me do the ctrl alt del dance all the time....
Found out that there are people called computer programmers that made software. Decided to give it a go since I had some free time most days. Started out with c++ because it was being recommended in some websites. Had many "oh deeeeer lord" moments. After not getting much traction I decided to move to Java which seemed like an easier step than C++. Had fun, but after some verbosity I decided to move into more dynamic lands. Tried JS and since at the time there was no Node and I was not very into the idea of building websites I decided to move into Python, Ruby, PHP and Perl and had a really great time using and learning all of them. I decided to get good in theoretical aspects of computer programming and since I had a knack for math I decided to get started with basic computer science concepts.
I absolutely frigging loved it. And not only that, but learning new things became an obsession, the kind that would make me go to bed at 02:40 am just to wake up at 04:00 or 06:00 because the military is like that. I really wanted to absorb as much as I could since I wanted to go to college for it and wanted to be prepared since I did not wanted to be a complete newb. Took Harvard CS50, Standford Programming 101 with Java, Rice's Python course and MIT's Python programming class. I had so much fun I don't regret it one bit.
By the time I got to college I had already made the jump to Linux and was an adept Arch user, Its not that it was superior or anything, but it really forced me to learn about Linux and working around a terminal and the internals of the system to get what I want. Now a days I settle for Fedora or Debian based systems since they are easier and time is money.
Uni was a breeze, math was fun and the programming classes seemed like glorified "Hello World" courses. I had fun, but not that much fun, most of my time was spent getting better at actual coding. I am no genius, nor my grades were super amazing(I did graduate with honors though) but I had fun, which never really happened in school before that.
While in school I took my first programming gig! It was in ASP.NET MVC, we were using C#, I got the job through a customer that I met at work, I was working in retail during the time and absolutely hated it. I remember being so excited with the gig, I got to meet other developers! Where I am from there aren't that many and most of them are very specialized, so they only get concerned with certain aspects of coding (e.g VBA developers.....) and that is until I met the lead dev. He was by far one of the biggest assholes I had ever met in my life. Absolutely nothing that I would do or say made hem not be a dick. My code was steady, but I would find bugs of incomplete stuff that he would do, whenever I would fix it he would belittle me and constantly remind me of my position as a "junior dev" in the company saying things as "if you have an issue with my code or standards tell me, but do not touch the code" which was funny considering that I would not be able to advance without those fixes. I quit not even 3 months latter because I could not stand the dick, neither 2 of the other developers since the immediately resigned after they got their own courage.
A year latter I was able to find myself another gig. I was hesitant for a moment since it was another remote position in which I had already had a crappy experience. Boy this one was bad. To be fair, this was on me since I had to get good with Lumen after only having some exposure to Laravel. Which I did mentioned repeatedly even though he did offer to train me in order to help him. Same thing, after a couple of weeks of being told how much I did not know I decided to get out.
That is 2 strikes.
So I waited a little while and took a position inside another company that was using vanilla PHP to build their services. Their system was solid though, the lead engineer remains a friend and I did learn a lot from him. I got contracted because they were looking for a Java developer. The salary was good. But when I got there they mentioned that they wanted a developer in Java...to build Android. At the time I was using Java with Spring so I though "well how hard can this be! I already use Android so the love for the system is there, lets do this!" And it was an intense, fun and really amazing experience.
-- To be continued.10 -
I developed a simple scholarship management system for my school using Laravel, MySQL, jQuery and Bootstrap, I did it for free since college students from my country have to pay social service to get their degrees. Everyone in the scholarships department seemed to be really happy with my work and they evaluated my social service with 10/10, but yesterday they asked for one last favor: to go talk to the new social service guy who'll be supposed to maintain my project, a mid 30's dude who was really pissed off from the beginning because he wasn't even able to deploy the project, he wasn't even able to clone the project from Github. Ok, so I tried to explain to him the tools I used and how the project was structured, but everything I said seemed to piss him even more, so I stopped and had a chat like:
Me: "Look man, do you know or at least have basic concepts of PHP and MVC frameworks?"
Guy: "Yes, but I'm a project manager, not just –despectively– any programmer, and you didn't write proper documentation, it's impossible to deploy your project with the manual you wrote, I cannot work like this".
*We go to their computer and I clone and setup the project in 3 minutes.
Guy: "Yes, but I still don't know how the project works, I need everything documented. If I have to change something, I don't know where to look.
Me: "Man, that's why asked you about knowing PHP MVC frameworks".
Guy: "I cannot work like this, nothing is documented, I don't even know what's that software you're using *points at Sublime Text*. Or tell me, can you arrive at a place where they expect you to work with something you don't know and they have no documentation?"
*At this point he was really pissed
Me: "Well... Dealing with non-documented software is what I do for a living"
Guy: "I don't know what companies you've worked for, probably not big ones..."
Me: "Well, I actually work for *I mention one of the biggest music apps in the country*"
*Guy ironically laughs
When I gave my feedback to the lady in charge of the department, I told her that this guy was really pissed off at how things were done and that I wasn't so sure of him being capable of maintaining the system. She told me not to worry, that the guy became a well known asshole in the office only after a few days, and that she'll probably have to find something else for him to do. It'd be hilarious if this guy ends up capturing scholarships in the system I made.4 -
Satoru Iwata.
You might remember it as the former president of Nintendo, but he was also a very impressive programmer. As he was president of HAL Laboratories, he helped with the development of Pokémon Stadium for the Nintendo 64 by porting the Pokémon Red/Blue battle system not by having any sort of documentation, but by reading the assembly source code.
He did so to allow Game Freak's developers (who were only a team of 4 at the time) to focus on their work on Pokémon Gold/Silver. But he did more: when they had to localize Red/Blue for America, they couldn't fit everything in a cartridge. They had the same problem while developing Gold/Silver, since cartridges had at most 8 Mb of storage capacity back then, and they had to fit not only the Johto region but the Kanto one as well! So Iwata stepped in, and created a graphics compression tool which managed to make everything fit in the cartridges.
He did this while not even being part of Nintendo, and the work was so impressive that the Pokémon devs thought it was "a waste to just have [him] as president!" (ie. why not make use of such programming skills).
Truly someone I look up to.8 -
The story of my webshop with this fuckin' asshole continues! I decided to stop with the webshop as my partner didn't do anything, so I handed over my shares to my business partner. This was done formally at the notary. Immediately after, we agreed that I would hand over everything that same week. 1 day later I cannot access any accounts. He said that a hand over was not necessary and that he took appropriate measures. Now, 4 months later, I got a letter from a collection agency telling me to hand over the tradename. Uhm what? Tradename? I don't own it so I replied that there's nothing to hand over. A day later again a letter that he will sue me if I don't hand over the tradename. Mr. Prick Lawyer, I understand that you mean the DOMAINname, but why the fuck do you keep referring to the tradename?! You too stupid to understand the difference? So, to get rid of this crap I made an offer to sell him the domainname, which he accepted. But mr. Asshole moved the shop to a different hostingprovider thinking that the dns would be magocally updated. Of course not asshole. So I offered (to be cooperative) to update dns so his site will work again. I did. A day later again a letter that site still not reachable and he'd sue me for all damages etc.
What a muppet show! You think ypu can sue me because YOU made a config mistake? He's a funny guy! I told the lawyer to not send me any 'issues' caused by mr. Asshole's unprofessional acting and if he does, I'll charge him for every second spent.
Today mr. Asshole's webshop says 'Apache is functioning normally' and that's it. Well done, asshole! See how eaay my job is and how little knowledge it requires? You proved ypu can do it yourself Big boy! Good luck selling shit on your website. Good luck with your seo rankings. And good luck fucking yourself in the ass!
Now I'm going to sue you because of copyrights violations. You use my software and you don't have a license. Either pay or remove it or I'll make you pay!5 -
So my friend, who owns a restaurant, asked me over 6 months ago, if i could redesign his homepage. I told him "sure why not" and since we're friends i didn't want him to pay me any money.
He told me what his thoughts about the design were and i told him that i needed the menu, some decent pictures of the restaurant, the "about us" story and the credentials to the server.
He didn't know the credentials to his server and i told him to ask the person, who made that page to send me the information i needed, but he kept on saying "could you call her because blah blah". Well, i did but she couldn't give me that info without asking the owner. So i met him and told him "hey i told you so, because it's completely normal not give sensible information to unknown people and besides that she told me to tell you that you should give her a call, because she hasn't got your new phone number". Two months later i got an email with the credentials, but still no menu and no pictures.
Four days ago i made a transition page, because i didn't want to publish the page with stock images and without menu, so i wrote him again whether he wanted design #1 or #2. Got a text at ~21:00 saying "design 2, but you need to publish it at 22:00".
I mean wtf?! He assured me he would call some people he knows to get those things. I told him, that it would be free, because of our friendship, but no support from him and he keeps stressing?! He knows i've got a full-time job and my studies going on, so my time is really limited and he keeps fking around like that?! Man it pisses me really off...11 -
!rant & story_time
This happend to the startup I was working for at ~2011. I was a junior Android dev, working on a very popular app.
During experiments for a new feature, I discovered that the system AlarmManager has a serious bug - you can set a repeating alarm with interval=0ms. If your app takes more then 1 ms to handle the Intent, then the AlarmManager will start to fill up the intent Queue, with unexpected results to the OS. causing it to slow down, and reboot when it ran out of Ram. Why? my guess was that because the AlarmManager was part of the OS, then any issues caused by it caused the system process to ran out of ram, crashing it, and the whole system with it. the real kicker was that even after a reboot, the AlarmManager still had Intents queued, causing the device to bootloop for a while, untill the queue was cleared. My boss decided to report the problem to google, as this was an issue in the OS. I built an example app, that caused the crash 10-30 seconds after starting, and submitted to Google. Google responded later that day with "not an issue, no one will ever do this".
Well... At this point I decided to review the autoupdate feature in our app, to make sure this will not happen to us. We just released a new feature where a user can set an update schedule option in the app settings - where you could setup a daily, weekly, or hourly update for the app. after reviewing it, It looked good, and the issue was not triggered in the manual QA I did. So, it was all good. And we released an updated version to the store.
After we did an update-install, we discoverd that, there was a provlem reading the previous version SharedPrefs value for the update schdule settings, and the value defaulted to 0...
the result was, our app caused all our users to go into a bootloop, and because the alarm was reset when the devices booted up, the bootloop could only be solved in a factory reset, or removing our app, before the device rebooted, and then waiting a few reboot cycles.
We lost 50 places in the market, and it took us 6 months to get back to where we were.
It was not my fault, but it sucked big time!4 -
-- How I succeeded turning a PHP/MYSQL app into Android app within a week --
Alright. So I wanted to grab your attention to what I'm about to write. If you are here just to read about the technologies I used, jump to bottom.
This is also a kind of rant; rant against the other fellow devs who demotivated me originally when I asked a question.
I'll not go in the details of my original question. Here's the link for those who are interested:
https://www.devrant.io/rants/366496
It's been days since I achieved what I wanted to but I thought someone might learn from my experience. So here it goes.
Why FREE?
Well, it was an important client. I worked on his website and he asked for an app for the same website and told me he won't be able to pay me anything for the app. I was, somewhat, under the impression that he might be testing me. If not, then I would end up learning something new. It wasn't a bad deal for me so I didn't hesitate to took it.
Within a week, I was able to pull the job and finish it. I felt so much better (and proud of myself) when I finished the app within the week and client approved it. What did I get? I got a GOOD BANK CLIENT in my pocket now. Got a lot more worth of projects from the same client. If I were being paid for the app, I might not have pulled the job so much better.
So the moral of this story is never to give up. NOT EVERY DEVELOPER SELLS SHORT ONLY FOR "MONEY". Some enjoy learning new things. And some like me love to accept new challenges and are not afraid to try something new everyday.
In case, someone is interested in knowing the technologies I used, here they go;
PhoneGap
Framework7
Template7
Apache Cordova
I wrote an API for the interaction between the web services and the app.
Also, Ionic Framework seems promising but it had a learning curve and time was of the essence. But I'm gonna learn it anyhow.13 -
Had a job interview back where I want to move(2300 miles away), doing exactly what I wanted. Unfortunately it was for a senior developer, a bit over my pay grade.
First Interview: "It is above your skill level, but I like you. We will make it fit you."
Second Interview(technical): " You did super well! I will make sure to pass the good news onto the boss! I am excited to work with you soon!"
Response to my thank you email: "We decided to not persue you further for this position. We are going with someone who has more experience."
Why string me along?!?!4 -
BRAIN_UNCAUGHT_EXCEPTION
Could not execute "sleep()", as main thread was busy thinking about why a beautiful girl would just handle me her number.
Ok we did get on well but it was unexpected nevertheless
Thank you brain for wasting my day 👍11 -
Please. Hear me out.
I've been doing frontend for six years already. I've been a junior dev, then in was all up to the CTO. I've worked for very small companies. Also, for the very large ones. Then, for huge enterprises. And also for startups. I've been developing for IE5.5, just for fun. I've done all kinds of stuff — accessibility, responsive design (with or without breakpoints), web components, workers, PWA, I've used frameworks from Backbone to React. My favourite language is CSS, and you probably know it. The bottom line is, you name it — I did it.
And, I want to say that Safari is a very good browser.
It's very fast. Especially on M1 Macs. Yes, it lacks customization and flexibility of Firefox, but general people, not developers, like to use it. Also, Safari is very important — Apple is a huge opposing force to Google when it comes to web standards. When Google pushes their BS like banning ad blockers, Apple never moves an inch. If we lose Safari, you'll notice.
As for the Safari-specific bugs situation, well… To me, Safari serves as a very good indicator: if your website breaks in Safari, chances are you used some hacks that are no good. Safari is a good litmus test I use to find the parts of my code that could've been better.
The only Safari-specific BUG I encountered was a blurry black segment in linear gradients that go from opaque to transparent. So, instead of linear-gradient(#f00, transparent), just do linear-gradient(#f00f, #f000).
This is the ONLY bug I encountered. Every single time my website broke in Safari other than that, was for some ugly hack I used.
You don't have to love it. I don't even use it, my browser of choice is Firefox. But, I'm grateful to Safari, just because it exists. Why? Well, if Safari ceases to exist, Google will just leave both W3C and WhatWG, and declare they'll be doing things their way from now on. Obey or die.
Firefox alone is just not big enough. But, together with Safari, they oppose Google's tyranny in web standards game.
Google will declare the victory and will turn the web into an authoritarian dictatorship. No ad blockers will be allowed. You won't be able to block Google's trackers. Google already owns the internet, well, almost, and this will be their final, devastating victory.
But Safari is the atlas that keeps the web from destruction.22 -
The fuck did you think was going to happen?
User: ITs dragging their feet which is why x hasn't gone out yet.
PM: Why hasn't this gone out yet?
Me: They sent me a template then another and then said wait that's wrong too I'll send you the correct one.
I've yet to receive this and no one's provided me the data to check over.
PM: Well that's not what x said.
Me: Well my email chain says so. (Proceed to show them the emails)
PM then walks off and blasts the users. Your #blamegame ended the moment you emailed me knob shits. -
Some motherfucker at the gym called me. “Hey @growling, I am here with that gym you signed up with 5 months ago and your card for membership renewal isn’t working.”
“It’s 8:00am”
“Yes sir. It’s 8am.”
“Don’t you think it’s a bit too early?”
“Did you get a new card?”
“Hey call me at lunch or something, I’m going back to sleep.”
“Okay, or you can call me. Goodbye”
Acting like you got better shit to do with your time.
Like he wanted to lecture me and say waking me up at 8am is fine. Like he wanted to say he came from a hardworking family and so he can say waking me up at 8am is fine. Shiiit dude my mom used to work with two broken hips for 7 days a week until I made six figures. Bless her heart, that’s why I got her a new car and money each month to pay all her bills. She’s been out of work for 2-3 years now. So lecture me. Only my mom can lecture me, boy. Cause she raised me to be an engineer.
Also, why do I see this everywhere as well? I get lectured for drinking beer on a Sunday or Monday during lunch at my frequent visits to liquor store.
“Don’t you have work?”
Yes, 9-5. But I’m an engineer. So it can be 10-6 or 11-7. Doesn’t matter. All of the stuff I do follows sprints and not direct interaction with customers!
I get tasks done and I teach interns to help me get tasks done. In time. And sometimes even more.
I know my schedule is so lax you want to criticize me. Maybe you think I don’t work? Or work as hard as you?
Tl;dr I intentionally act like a spoiled baby when it comes to work so that service/retail/manual labor people lecture me so I can tell them that we work differently than what they’re used to.
I have free snacks. Don’t get me started about gloating about free beef jerky. People hate me on online forums for doing that! Drink beer on tap in work kitchen. A glass of wine anytime I want. Sleep in until sometimes 11am. But that’s why I’m an engineer, buddy.2 -
Well, some time in the future, i will have to sit a computer science exam with C#. It can't be that bad, right?
Wrong.
To start off, Visual Studio 2013. Why the fuck someone would use this pile of garbage in 2018. I have no fucking clue why any semi-competent IT department would decide to skip TWO fucking releases of the software and decide, that it's okay to just roll with it. It's okay to not have any updates. It's okay to just no care at all.
I literally brought in my laptop with a VM installed since Visual Studio 2017 is really superior to the crap from 5 years ago just to do my coursework most lessons.
-------
Second issue, you know thoes desks where the monitor is literally under the desk and you get a small little window to see the monitor? Yeah, well I will have to take my proper exam in one of these all over the fucking room. Pic related.
Today we had a mini mock - - it went something like this:
- There was glare from the glsss on the desk because of the lights in the room and literally the monitor itself.
- The glass was beyond fucking pig filthy.
- There was neck pain from my back because i was constantly looking down and bending over the see the screen.
- There was eye strain because the document given to us was a tiny piece of paper with tiny writing and the monitor was far away and the paper was close i couldn't focus my eyes.
- Literally every desk was as bad as the next.
- I did fuck all work because i just couldn't focus because of the things above.
You can tell how great that felt.
If i was in a room with a man (or if it was a woman, let's just pretend she has balls), who was the creator of the room i just described, Hitler, my College's IT staff and other really bad people while having infinite ammo, i would continuously shoot the creator in the balls while not giving a shit about anything else.
Forever.
Until heat death.
Thanks for reading.23 -
Be me, new dev on a team. Taking a look through source code to get up to speed.
Dev: **thinking to self** why is there no package lock.. let me bring this up to boss man
Dev: hey boss man, you’ve got no package lock, did we forget to commit it?
Manager: no I don’t like package locks.
Dev: ...why?
Manager: they fuck up computer. The project never ran with a package lock.
Dev: ..how will you make sure that every dev has the same packages while developing?
Manager: don’t worry, I’ve done this before, we haven’t had any issues.
**couple weeks goes by**
Dev: pushes code
Manager: hey your feature is not working on my machine
Dev: it’s working on mine, and the dev servers. Let’s take a look and see
**finds out he deletes his package lock every time he does npm install, so therefore he literally has the latest of like a 50 packages with no testing**
Dev: well you see you have some packages here that updates, and have broken some of the features.
Manager: >=|, fix it.
Dev: commit a working package lock so we’re all on the same.
Manager: just set the package version to whatever works.
Dev: okay
**more weeks go by**
Manager: why are we having so many issues between devs, why are things working on some computers and not others??? We can’t be having this it’s wasting time.
Dev: **takes a look at everyone’s packages** we all have different packages.
Manager: that’s it, no one can use Mac computers. You must use these windows computers, and you must install npm v6.0 and node v15.11. Everyone must have the same system and software install to guarantee we’re all on the same page
Dev: so can we also commit package lock so we’re all having the same packages as well?
Manager: No, package locks don’t work.
**few days go by**
Manager: GUYS WHY IS THE CODE DEPLOYING TO PRODUCTION NOT WORKING. IT WAS WORKING IN DEV
DEV: **looks at packages**, when the project was built on dev on 9/1 package x was on version 1.1, when it was approved and moved to prod on 9/3 package x was now on version 1.2 which was a change that broke our code.
Manager: CHANGE THE DEPLOYMENT SCRIPTS THEN. MAKE PROD RSYNC NODE_MODULES WITH DEV
Dev: okay
Manager: just trust me, I’ve been doing this for years
Who the fuck put this man in charge.11 -
I have got a new director at work. My previous director had to retire already, the man was already feeling it and he had been on the institution for more than 35 years....I am 30, so this tells you how much the man has been there.
This new dude.....has the presence of a Caterprie (Pokemon) or an Oompa Loompa. In contrast, the previous director felt like a 4 star General (never been in the presence of a 5 star since those occurrences are world war rare) but I had respected that man so much and loved working with him. I really did loved my boss, he was stern and professional, but kind and friendly to his staff, fiercely protective, no one took advantage of I.T while he was there, he would literally fight for us and took our word before anything else. The man was, well, a true man. A true leader.
He took a chance in putting me as the head of my department, but he had faith in me, and coached me and trained me as much as he could. Had the requirement for his position not been a masters he himself told me that he would have loved to make me his successor, even when I would constantly tell him that I was scared shitless of the work he did and the amount of things he did for the institution, to me this is a very laaaaaaaaarge cowboy hat to fill (this is Texas, he wore a hat, the saying is normally "shoes to fill", but fuck it)
This new guys looks away when the other managers are speaking to him. He constantly interrupts us. He constantly tells us about how the other institution in which he was (rival might I add) does X or Y, its fucking annoying to the point that me and the other managers have a drinking game, for every time he references his old institution we drink one beer over the weekend. It is Saturday night and I am 36 in in total (this is my favorite part of it tho) and it is just annoying.
His train of thought makes no sense to me:
"This application, where did you buy it? we tried purchasing one on Y when I was still there but found none"
Me: "Well, since it was a new government mandate and had nowhere to go we had to develop it in house"
Him: "We had tried to purchase what you guys had but found no place that sold it, so why didn't you try purchasing it?"
Me:.....well, because it was brand new, purchase it from where? We also don't like dealing with vendors that manage these sorts of things because every new requirement takes them weeks to produce on very high budgets, historically, my department has only had maintenance fees for the software that we have and even those applications crap themselves all the time and they take weeks to answer back to us.
Him: So you decided to develop it in house instead? we would never do that! back at y we purchased everything our engineers never really developed anything!
Me: Well then, what is the purpose of having engineers if they are not going to actually develop an application?
Him: IF there is something out there that is better then why should you reinvent the wheel?
Me: For this one I did not reinvent the wheel, I am not talking about creating a programming language from scratch, but how does custom solutions that specifically feed the needs of the institution to be produced otherwise? The department has developers for a reason, because they have very specific needs in here that can only come from a team of developers that are in house satisfying those needs.
Him: Well our engineers never had to do that. Sure projects sometimes had to put on holds because the vendor was busy, but such is the nature of development
Me: No it is not, the nature of development is to create things, it is one thing for my team to go through bugs and software considerations, it is another for me to not provide a service because some random company is taking two weeks on a $300 dllr an hour contract to put a simple checkbox on a form. If a project fails the board is not going to care that some vendor is not doing their job, they are just going to blame me, if that is the case then I would much rather the blame be actually mine than some sucky third party "developer" also, your engineers where not even engineers, they were people with a degree that purchased things, that's it, please do not compare them to my guys or refer them as engineers in front of me, they are not.
Him: Well, maybe.
MAYBE?!! motherfucker I did not kill myself learning the ins and outs of architecture and software engineering on my own time after my fucking bachelors in C.S for your codeless background ass to tell me MAYBE. My word IS the fucking WORD here, not yours. Fuck me I really dislike this dude's management practices.
The shitty part? He is not a bad person, he is not a bad dude that is out to get us, just a simple minded moron with no place as a leader.
I know leaders, I know what a leader is, this is not one.10 -
My code review nightmare part 2
Team responsible for code 'quality' dictated in their 18+ page coding standard document that all the references in the 'using' block be sorted alphabetically. Easy enough in Visual Studio with the right-click -> 'Remove and Sort Usings', so I thought.
Called into a conference room with other devs and the area manager (because 'Toby' needed an audience) focusing on my lack of code quality and not adhering to the coding standard.
The numerous files in question were unit tests files
using Microsoft.VisualStudio.TestTools.UnitTesting;
using System.Collections.Generic;
using System.Linq;
<the rest of the usings>
T: "As you can see, none of these files' usings are in alphabetical order"
Me: "Um, I think they are. M comes before S"
T: "The standards clearly dictate system level references are to be sorted first."
Mgr: "Yes, why didn't you sort before checking this code in? T couldn't have made the standards any easier to follow. All you had to do is right-click and sort."
Me: "I did. M comes before S."
T: "No You Didn't! That is not a system reference!"
Me: "I disagree. MSTest references are considered a system level reference, but whatever, I'll move that one line if it upsets you that much."
Mgr: "OK smartass, that's enough disrespect. Just follow the fucking standard."
T: "And learn to sort. It's easy. You should have learned that in college"
<Mgr and T have a laugh>
Me: "Are all your unit tests up to standard? I mean, are the usings sorted correctly?"
T:"Um..well..of course they are!"
Me: "Lets take a look."
I had no idea, a sorted usings seems like a detail no one cares about that much and something people do when bored. I navigate to project I knew T was working on and found nearly all the file's usings weren't sorted. I pick on one..
using NUnit;
using Microsoft.Something.Other;
using System;
<the rest of the usings>
Me: "These aren't sorted..."
T: "Uh..um...hey...this file is sorted. N comes before M!"
Me: "Say that again. A little louder please."
Mgr: "NUnit is a system level nuget package. It's fine. We're not wasting time fixing some bug in how Visual Studio sorts"
Me: "Bug? What?..wait...and having me update 10 or so files isn't a waste of time?"
Mgr: "No! Coding standards are never a waste of time! We're done here. This meeting is to review your code and not T's. Fix your bugs and re-submit the code for review..today!"17 -
One Thursday noon,
operation manager: (looking at mobile)what the.....something is wrong i am getting bunch of emails about orders getting confirmed.
Colleague dev: (checks the main email where it gets all email sent/received) holy shit all of our clients getting confirmation email for orders which were already cancelled/incomplete.
Me: imediately contacting bluehost support, asking them to down the server so just that we can stopp it, 600+ emails were already sent and people keep getting it.
*calls head of IT* telling the situation because he's not in the office atm.
CEO: wtf is happening with my business, is it a hacker?
*so we have a intrusion somebody messed the site with a script or something*
All of us(dev) sits on the code finding the vulnerabilities , trying to track the issue that how somebody was able to do that.
*After an hour*
So we have gone through almost easch function written in the code which could possibly cause that but unable to find anything which could break it.
Head asking op when did you started getting it actually?
Op: right after 12 pm.
*an other hour passes*
Head: (checking the logs) so right after the last commit, site got updated too?. And....and.....wtf what da hell who wrote this shit in last commit?
* this fuckin query is missing damn where clause* 🤬
Me: me 😰
*long pause, everyone looking at me and i couldn't look at anyone*
The shame and me that how can i do that.
Head: so its you not any intrudor 😡
Further investigating, what the holy mother of #_/&;=568 why cronjob doesn't check how old the order is. Why why why.
(So basically this happened, because of that query all cancelled/incomplete orders got updated damage done already, helping it the cronjob running on all of them sending clients email and with that function some other values got updated too, inshort the whole db is fucked up.)
and now they know who did it as well.
*Head after some time cooling down, asked me the solution for the mess i create*
Me: i took backup just couple of days before i can restore that with a script and can do manual stuff for the recent 2 days. ( operation manager was already calling people and apologising from our side )
Head: okay do it now.
Me: *in panic* wrote a script to restore the records ( checking what i wrote 100000000 times now ), ran...tested...all working...restored the data.
after that wrote an apology email, because of me staff had to work alot and it becomes so hectic just because of me.
* at the end of the day CEO, head, staff accepted apology and asked me to be careful next time, so it actually teached me a lesson and i always always try to be more careful now especially with quries. People are really good here so that's how it goes* 🙂2 -
After returning back from the company we were purchasing a new phone system (hardware+software, $100K+, kind of a big deal)
VP: “I need the new phone system software integration for our CRM by next week. I need to demo the system for the other VPs”
Me: “No problem. Were you able to get their API like I asked?”
VP: “Salesman didn’t know for sure what that was, but he said all the developer software documentation is on their site.”
Me: “Did he give you a URL? Their main site is all marketing mumbo-jumbo. I assume there is another one specific for developers.”
VP: “Yea, he might have said something, but I don’t understand why you need it. The salesman said the integration would be seamless. He showed me several demos.”
Me: “No, I mean I need to know, is the API a full client install? a simple dll? is this going to be a web service integration? How will I know what to program against?”
VP: “I think I heard him say something about COM? Does that sound like an API?”
Me: “It’s a start. Did he provide you anything, a disk, a flash drive, anything with the software?”
VP: “No, only thing he told me was our CRM integration would be seamless and our development team would have no problems.”
Me: “OK..OK…I get it…he’s a salesman. Is there an 1-800 number I can call? A technical support email address? Anyone technical I can reach out to?”
VP: “Probably, but I don’t understand what the problem is. I need the CRM integrated by next week. I gave the other VPs a promise we would get it done. I do not break promises.”
Me: “Wait…when are we installing the new system?”
VP: “Well, the purchase order will be cut at the end of the month’s billing cycle, the company has about a two month turnaround time to deliver and install the hardware, so maybe 3 months from now? Are you going to be able to have the integration ready for next week?”
Me: “If we won’t see any of the hardware for 3 months, what exactly am I integrating with?”
VP: “That API you wanted or whatever it is. COM…yea, it’s COM. I was told the integration would be seamless and our developers would have no problem. I don’t understand why you can’t simply write the code to make it work. Getting the hardware installed is going to be the hardest part.”
Me: “OK, so I have no documentation, we have no hardware, no software, and no idea what this ‘seamless integration’ means. I’m afraid there isn’t anything I can do right now. ”
VP: “Fine!...I’ll just have to tell the other VPs you were not able to execute the seamless integration with the CRM.”
Which he did. When the hardware+software was finally installed, they hired consultants (because I “failed”). I think the bill was in the $50K range to perform the ‘integration’ which consisted of Excel spreadsheets (no kidding). When approached with the primary CRM integration, the team needed our API documentation, a year’s development time and $300K. I was pissed off enough, and I had the API documentation, I was able to get the basic CRM integration within 3 days. When an agent receives a call, I look up the # in our database, auto-fill the form with the customer info, etc. Easy stuff when you have the documentation.
The basics worked and the VP was congratulated by ‘saving’ the company $300K. May or may not have been bonuses involved, rumors still out on that one, but I didn't see em'. Later my manager told me the VP was really ticked that I performed the integration ‘behind his back’, but because it was a success, he couldn’t fire me.10 -
It was friday evening and almost everyone in office had left. I was assigned a bug related to some of my code changes. I called my senior to help me debug (has three years of experience, whereas me having only one year exp, who is also a very good friend of mine *always helps in debugging*).
So the code goes
switch (someEnum) {
case One:
doSomething()
// no break
case Two:
t.x = someEnum
break
case Three:
.....
}
I had recently added new enun One and was reciting the code logic to him as we were looking through code.
Him: Hey you haven't set t.x in case One. How did you miss that?
Me: No look, I haven't but a break on it. It will go ahead and set it in next case.
Him: What are you talking about? if the someEnun is One why would it execute Two case. Lets copy that line up there and try it locally.
Me: No no no wait. Are you saying that groovy doesn't need breaks in switch (Me being new to groovy but good with Java).
Him: Why would you need break in switch case even in Java?
Me: *stares at him*
Him: I'm going to execute a psvm right freaking now.
Me: *while he writes the psvm* Why did you think there were breaks in switch in any code?
Him: Shut up. *writes psvm code cursing me everywhere*
*executes code*
No way. Really??
Me: Tell me why do you think are there breaks in switch.
Him: I though they were to get you out of switch block and not execute the default block.
Me: So were you coding switch until now without breaks?
Him: I don't know man. I'm starting to doubt all the switches I have ever written.
Me: Anyway that's not the problem, so moving on.
*a while later*
Him: If a interviewer would ask me how would you rate yourself in Java. I would be like "Well I worked on various projects for 3 years in Java, but didnt know why we put breaks in switch. So you figure it out yourself."
One of the best moments in office.8 -
Got this from boss (a few colleagues got it as well):
Sites have been down over the weekend and seems the only person cares is PM! There is a condition about working when required (i.e. unpaid OT) on your contract! It is essential that sites are properly managed even at weekends - we run a online business! If anyone has problems we'll discuss next week
*Note: site was partially down and there was no major impact on the business
When I explained why we need to rebuild the sites, you said not now - almost 2 years now, still nothing happens.
When I asked if we can get managed hosting or load balancer, fecking NO again
After asking for my opinion on the sites, you & the puppet think my honesty is me being negative and incorporate, and exclude me from meetings and major part of my work
Go fuck yourself! I've warned you about the status of the sites and you did not want to listen SO DON'T TELL ME I'M NOT DOING MY JOB WHEN YOU'RE THE ONE STOPPING ME FROM DOING IT PROPERLY!
I'm sure we'll have our meeting very soon, cheapskate.10 -
I was called over by a colleague. She needed help because her computer kept telling her that she did not have permission to run certain programs or access certain files.
She logged in to Windows in front of me. The first thing that I noticed that the username was her office email address. I asked her about it.
Me: Why is your username your email address?
Her: It was this way when I got it.
Me: That is impossible. I made every Windows installation here and I always use the same username which is [companyname] as it is our policy.
Her: I'm telling you, this is the way it was when I got it.
Me: Are completely sure?
Her: Well.... someone else must have renamed it.
Me: So someone fired up your laptop, used your password to log in and changed the username to your email?
Her: I don't understand it either. Is it possible that it happened accidentally, on its own?
Me: ...
Then I explained to her that changing the username on Windows 10 may result in problems with file permissions.
I am not mad because she didn't know about this. I am mad because of her idiotic lies.5 -
Ruby’s fanciness bit me in the butt today. It’s pretty rare, but often confusing AF when it happens.
array = [1, 2, 3, 4, 5, 6, 7]
array.count +1 +2
# => 1
What the fuck?
array.count +1 +2 +3
# => 1
What the fuck?
+1 +2 +3
# => 6
Okay.
(array.count +1 +2 +3)
# => 1
What the fuck?
(7 +1 +2 +3)
# => 13
Okay...
array.count + 1 + 2 + 3
# => 13
Alright, so spaces matter here...?
((array.count) +1 +2 +3)
# => 13
But not here!? ... Oh. I think I know what’s going on.
Array#count
Returns the number of elements. If an argument is given, counts the number of elements which equal it using ==
Well fuck me.
Ruby is seeing `array.count(+1+2+3)` instead of `array.count()+1+2+3` since `+1` is a value, not an operator followed by a value as is the case with `+ 1`.
Now, why was I using +1 +2 instead of adding some spaces like I normally would? So they would match what was in the comment next to them for easier reference. Heh.
Future dev, I did this for you! So this is all your fault. :|36 -
Boss: Client wants those stockphotos for the frontpage.
Me: ok. Please license them and let me know. I will upload them to the page.
Boss: How does that work then?
Me: you have to buy the five credit package. Here is the link...
Boss: (no response)
...few days later...
Boss: please remember to upload those images...
Me: well ok. Did you buy them?
Boss: isn't that your thing?
Me: I don't understand. You had all the info. You new where to buy them. You knew what images to buy since the client sent the preview versions. What do you need? ...and why didn't you tell me that you were waiting for my input? I was the last one to reply to this conversation.
Boss: i don't want to buy the wrong images.
Me: just buy the ones the client chose.
Boss: I don't want to look up the email he sent them in.
Me: I don't understand. I directly replied to that mail. It is in the same conversation.
Boss: ok.
...day later...
Boss sends me mail with images attached.
Boss: are those the right images?
Me: well yes. Those are the ones the client sent. I don't have more information than you.
(Me looking at the attachments and finding them in the smallest resolution available.)
Me: why did you download the images in the smallest resolution? It does not make any difference in price.
Boss: well I thought they were not needed in a bigger size.
Me: why do you make my options intentionally smaller? I am the guy doing frontend.
..please give me the login info for the stock account so I can download the images in a better resolution.8 -
An excerpt from the best rant about whiteboard interviews posted on the internet. Ever.
"Well, maybe your maximum subsequence problem is a truly shitty interview problem. You are putting your interview candidate in a situation where their employment hinges on a trivia question. — Kadane's algorithm! They know it, or they don't. If they do, then congratulations, you just met an engineer that recently studied Kadane's algorithm.
Which any other reasonably competent programmer could do by reading Wikipedia.
And if they don't, well, that just proves how smart the interviewer is. At which point the interviewer will be sure to tell you how many people couldn't answer his trivially simple interview question.
Find a spanning tree across a graph where the edges have minimal weight. Maybe one programmer in ten thousand — and I’m being generous — has ever implemented this algorithm in production code. There are only a few highly specific vertical fields in the industry that have a use for it. Despite the fact that next to no one uses it, the question must be asked during job interviews, and you must write production-quality code without looking it up, because surely you know Kruskal’s algorithm; it’s trivial.
Question: why are manhole covers round? Answer: they’re not just round, if you live in London; they're triangular and rectangular and a bunch of other shapes. Why is your interview question broken? Why did you just crib an interview question without researching whether its internal assumption was correct? Do you think that “round manhole covers are easier to roll" is a good answer? Have you ever tried to roll an iron coin that weighs up to 300 pounds? Did you survive? Do you think that “manhole covers are circular so that they don’t fall into manholes” is a good answer? Do you know what a curve of constant width is? Do you know what a Reuleaux triangle is? Have you ever even been to London?
If the purpose of interviewing was to play stump the candidate, I’d just ask you questions from my area of specialization. “What are the windowing conditions which, during the lapping operation on a modified discrete cosine transform, guarantee that the resynthesis achieves perfect reconstruction?” The answer of course is the Princen-Bradley condition! Everyone knows that’s when your windowing function satisfies the conditions h(k)2+h(k+N)2=1 (the lapping regions of the window, squared, should sum to one) and h(k)=h(2N−1−k) (the window should be symmetric). That’s fundamental computer science. So obvious, even a child should know the answer to that one. It’s trivial. You embarrass your entire extended family with your galactic stupidity, which is so vast that its value can only be stored in a double, because a float has insufficient range:"
Author: John Byrd
Src: https://quora.com/What-is-the-harde...3 -
I was on vacation when my employer’s new fiscal year started. My manager let me take vacation because it’s not like anything critical was going to happen. Well, joke was on us because we didn’t foresee the stupidity of others…
I had to update a few product codes in the website’s web config and deploy those changes. I was only going to be logged in for 30 minutes to complete that.
I get messaged by one of our database admins. He was doing testing and was unable to complete a payment on the website. That was strange. There was a change pushed by our offsite dev agency, but that was all frontend changes (just updating text) and wouldn’t affect payments.
We don’t want to enlist the dev agency for debugging work, especially when it’s not likely that it’s a code issue. But I was on vacation and I couldn’t stay online past the time I had budgeted for. So my employer enlists the dev agency for help. It’s going to be costly because the agency is in Lithuania, it was past their business hours, and it was emergency support.
Dev agency looks at error logs. There are Apple Pay errors, but that doesn’t explain why non Apple Pay transactions aren’t going through. They roll back my deployment and theirs, but no change. They tell my employer to contact our payment processor.
My manager and the Product Manager contact Payroll, who is the stakeholder for our payment gateways. Payroll contacts our payment gateway and finds out a service called Decision Manager was recently configured for our account. Decision Manager was declining all payments. Payroll was not the person who had Decision Manager installed and our account using this service was news to her.
Payroll works with our payment processor to get payments working again. The damage is pretty severe. Online payments were down for at least 12 hours. Our call center had logged reports from customers the night before.
At our post mortem, we had to find out who ok’d Decision Manager without telling anyone. Luckily, it was quick work. The first stakeholder up was for the Fundraising Dept. She said it wasn’t her or anyone on her team. Our VP of Analytics broke it to her that our payment processor gave us the name of the person who ok’d Decision Manager and it was someone on the Fundraising team. Fundraising then starts backtracking and says that oh yes she knew about it but transactions were still working after the Decision Manager had been configured. WTAF.
Everyone is dumbfounded by this. How could you make a big change to our payment processor and not tell anyone? How did our payment processor allow you to make this change when you’re not the account admin (you’re just a user)?
Our company head had to give an awkward speech about communication and how it’s important. The web team can’t figure out issues if you don’t tell us what you did. The company head was pissed because it was a shitty way to start off the new fiscal year. Our bill for the dev agency must have been over $1000 for debugging work that wasn’t helpful.
Amazingly, no one was fired.4 -
At a meeting:
"We don't know why <past developer, they all know who this motherfucker is> did it this way but we have to..."
Me: *slams table* no, stop. I am tired of this. Y'all must've really liked this guy. But he did it this way because he was a fucking idiot.
A
Fucking
Idiot
There is no other reason for this amount of fuckery that I have to be bothered to fix and mess with on A DAILY BASIS so I am gonna go ahead and call it as it is. The dude was a damn moron and no one here stopped him. I know he was a janitor here that got his cute lil associates and y'all wanted some good will hunting shit to happen, but <said dumbass developer is no matt damon"
Them: "YOU CaNt JusT UsE ThaT lanGUAGE"
"Am i gonna fix this shit?"
"Well......no one else kno...."
Me: "exactly"
Legit man i am sick and tired of this shit. I did not earn a B.S in comp sci. Graduated in the top percentage of my class, am suffering through my MCS to fix php like a fucking moron all day.The rest of my web devs backed me up.
Aaaand btw..no, it is not my job. I am a fucking analyst, i provide data reports, i program said reports, i am tasked with this shit because i used to work for then as a web tech.....got a different position cuz i was tired of it...fuck me right?18 -
Back in the day, I joined a little agency in Cape Town, small team small office with big projects, projects they weren’t really supposed to take on but hey when the owner of a tech business is not a tech person they do weird things.
A month had passed and it was all good, then came a project from Europe, Poland to be specific. The manager introduced me to the project, it was a big brand - a segment of Lego, built on Umbraco (they should change the name to slowbraco or uhmmm..braco somewhere there) the manager was like so this one is gonna be quite a challenge and I remember you said you are keen on that, I was like hell yeah bring it on (genuinely I got excited) now the challenge was not even about complexity of the problem or code or algorithms etc you get my point… the challenge was that the fucking site was in polish - face palm 1 - so I am like okay code is code, its just content, and I already speak/familiar with 13 human languages so I can’t fail here ill get around it somehow. So I spin up IIS, do the things and boom dev environment is ready for some kick ass McCoding. I start to run through the project to dig into the previous dev’s soul. I could not relate, I could not understand. I could not read, I could not, I could not. - face palm 2 - This dude straight up coded this project in polish variable names in polish, class names in polish, comments in freaking polish. Look, I have no beef with the initial guy, its his language so why not right? sure. But not hey this is my life and now I should learn polish, so screw it, new tab - google translate, new notes, I create a dictionary of variables and class etc 3 days go by and I am fucking polish bro. Come at me. I get to read the previous devs soul through his comments, what a cool dude, his code wasn’t shit either - huge relief. So I rock on and make the required changes and further functionality. The project manager is like really, you did it? I am like yeah dude, there it is. Then I realise I wasn’t the first on this, this dude done tried others and it didn’t go down well, they refused. - face palm 3 -
Anyway, now I am a rock star in the office, and to project managers this win means okay throw him in the deep - they move me to huge project that is already late of course and apparently since I am able to use google translate, I can now defeat time, let the travelling begin. - face palm 4 - I start on the project and they love me on it as they can see major progress however poland was knocking on the door again, they need a whole chunk of work done. I can’t leave the bigger project, so it was decided that the new guy on Monday will start his polish lessons - he has no idea, probably excited to start a new job, meanwhile a shit storm is being prepared for him.
Monday comes, hello x - meet the team, team meets x
Manager - please join our meeting.
I join the meeting, the manager tells me to assist the new dev to get set up.
Me: Sure, did you tell him about he site?
Manager: Yes, I told him you knocked it out the park and now we just need to keep going
Me: in my head (hmm… that’s not what I was asking but cool I guess he will see soon enough -internal face palm 5 - ) New dev is setup, he looks at the project, I am ask him if he is good after like an hour he is like yeah all good. But his face is pink so I figured, no brother man is not okay. But I let him be and give him space.
Lunch time comes, he heads out for lunch. 1hr 15mins later, project manager is like, is the new dude still at lunch.
We are all like yeah probably. 2hrs pass 3hrs pass Now we are like okay maybe something happened to him, hit by a car? Emergency? Something… So I am legit worried now, I ask the manager to maybe give him a ring. Manager tries to call. NOTHING, no response. nada.
Next day, 8am, 9am, 10am no sign of the dude. I go to the manager, ask him what’s up. Manager: he is okay. However he said he is not coming back.7 -
Fuck Apple and its review system
So, this started in december. We wanted to publsih an app, after years of development.
Submit to review, and passes on the first try. Well, what do you know. We are on manual release option, so we can release together with the android counterpart. Well yes, but someone notices that the app name is not what was aggreed (App Name instead of AppName). Okay, should be easy, submit the same app, just the name changed. If it passed once, it will pass again, right? HAH
Rejected, because the description, why we use the device’s camera is too general. Well... its the purpose of the app... but whatever, i read the guidelines, okay, its actually documented with exapmles. BUT THEN WHY THE FUCK COULDNT YOU SAY THAT ON THE FIRST UPLOAD?
Whatever, fix it, new version, accepted, ready to release just in time.
It doesindeed roll out,but of course, we notice that the app has a giant issue, but only on specific phones. None of our test phones had this problem, but those who have, essentially cannot use our program. Nasty as it is, the fix is really easy, done in 5 minutes. Upload it asap, literally nothing changed from user point of view, except now it doesnt crash on said devices. Meanwhile 1 star reviews are arriving from these users - of course with all the right. Apple should allow this patch quickly, right? HAH
THE REAL BULLSHIT COMES NOW
With only config files changed, the same binary uploaded we get rejected? What now? Lets read it. “Metadata rejected, no need to upload new binary”.... oh fine only the store page is wrong? Easy. Read the message, what went wrong. “Referencing third party content is nit permitted on the app store” meaning that no android test device should be shown. Fine, your rules. They even send a picutre of the offending element. BUT ITS NOT EVEN ON THE STORE. THATS A SCREENSHOT OF THE APP. HOW IS THAT METADATA? I ask about this, and i get a reply, from either a bot, or a person who cant speak or read english, and only pasted a sample answer, repeating the previous message. WTF. Fine, i guess you are dumb, but since they stop replying to our queries, do the only sensible thing, re-record the offending tutorial video that actually contained an android device. This is about 2 weeks, after the first try to apply a simple patch to a broken app. And still, how did it pass the review 2 times?
Whatever, reupload again, play the waiting game for a week, when the promised average wait time is 2 days, they hit us with a message, that they want to know what patent we use in our apps core functionality. WTF WHY NOW? It didnt bother you for a month, let it release ti production and now you delay a simple patch for this? We send them what they know. Aaaaand they reply: sorry we need more time to review your app. FUUUUUUCKKK YOUUU. You are reviewing a PATCH with close to zero functional change!!! Then, this shit goes on, every week we ask about an ETA, always asking for patience... at the end it took another 3 weeks... so december 15 to jan 21 in total...
FOR. A. SINGLE. FUCKING. PATCH
Bottom line is what is infurating, apple cares that there is an android device in the tutorial video, but they dont care that a significant percentage of our users simply cannot use the app.
Im done7 -
Old client texted me yesterday: the website and pos system you made does not work anymore... Why ?
I saw that their domain was moved to another host and texted back: "some has moved the domain so that's why."
Client: "how can this be fixed"
Me: "move the domain back"
Client: "but then the new system I bought cannot function".
Me: oh well, then you are in trouble, if the new company you hired to make you a new system and website had been using just a little brain power, this would not happen. Now you have to bring your new system up and working before you open your store...
I could have helped them by pointing a sub domain to the server, but he never ever treated me with respect, and never payed in time, and he did not tell me about this move before he initiated it.
Me: shuts down server and thingking: good luck working with those new "professionals"4 -
Follow-up to https://devrant.com/rants/1551635
I think that I've found the reason for this Acer motherboard's refusal to boot up now. Apparently this featureful piece of shit expects "something" on its ID pin as well.. and why ID pin you may ask? I reckon that it's because of "certified replacements". Because you know, if it doesn't come from our shitty factorias it's gotta be shit, right?!
How about no?!! You Acer really aren't the only ones capable of producing a fucking lithium battery! And did you ever think of the edge cases where you may want to feed a lab bench power supply's voltage into the phone to mimic the battery and troubleshoot the bloody thing? Because that's what I initially wanted to do, instead of that Doogee battery. The only reason why I didn't is because the supply is currently charging up another lithium cell that I salvaged from a donated (broken) Samsung tablet, and is taking longer than expected.
Point is, if you receive the appropriate fucking level of angry pixies, YOU SHOULD FUCKING USE THEM AND BOOT UP ALREADY!!! Regardless of whether it's some sort of certified fucking Acer component or not! Somewhere between 4.2 and 2.7V stable should be good enough regardless of what produces it!
At least AliExpress sells these batteries for about €4.5, and another €2 for shipping. Considering that I can buy batteries with this capacity for €2 a pop and free shipping, this would better fucking work. Especially since I'm buying an overpriced battery of which almost half the cost is fucking shipping, just for a stupid "certified" controller that' I'll also have to put between the board and any pixie wrangler or angry pixie containment device that I use to power this shitty board. Acer, you motherfuckers!!!1 -
You know. I have mixed feelings on the way people have been reacting to senzory's rant regarding the way he deals with clients. Some people believe that he is unethical, some people see it as just business(me included) but to see what the community says is somewhat interesting.
First, let me be clear on something: i have been fucked over by clients many times for being a nice guy and trying to play it nicely.
Because of this I am selective of who deserves good treatment and who gets to fuck off. But regardless of the client I do the same thing: regardless of who it is, nice or otherwise. If a project will take 1 week to complete then I tell them that it will take 3 to 4 weeks. Why? Well because I have many things on my plate, I am married and have two children, one lives with me and I try to spend as much time with them as I can. I work from 8 to 6, sometimes later and when I get home I sometimes don't do shit since at work I maintain the web services of 2 fucking college campuses.
I don't look for my clients. Through word of mouth they come to me. And being in a privileged position(there are about 5 devs here and they all suck) they can either do with my times and fees or can fuck off over the border where Pedro will do their shit on vbscript and classic ASP(which I like, but you know why this is not an option in 2018)
Apps can be sold for large quantities of money, regardless of what their use case is, if a company wants to outsource their apps to an external developer(such as yours truly) that means that they are willing to play the game. And that is what business is: a game, a survival game.
Where I live, a company will not think twice of firing a single mother for whatever reason. In the U.S of A, and specially in Texas, you can be fired for whatever reason. I have automated people's jobs without knowing it, I have made people lose their jobs and saved companies thousands with my apps. Things like that were not know to me, had I known that someone would have lost their jobs I would have tried differently.
If a company is willing to tell employees(loyal employees) to fuck off, then i do not regret charging what I do and hustling the way I do with rat faced dickheads that care not for people. If I could I would destroy entire companies here. But that is for another story.
I have been used, insulted, gambled with and have been lied to, to my face by these companies. Which has left me jaded.
Oh now, trust me. I am still highly optimistic and nice. And if someone has a small business and I can help them out, then I will lower my rate and give positive vibes in the hopes of making things better through karma. I want to see the best in people. But this does not stop me from being a shark and giving quotes the way I do.
Because companies, as an overall entity are not people with the best intentions(sometimes) and they will not take your kindness, they will take advantage if possible in an effort to save money. Its just dickhead business.
So why, as a professional and privileged developer that obtained his skills through intense study and practice, a wizard by all means, should lower to these nameless, Faceless entities?
Why should i give them the fairness they do not give others? Why should I play the high morale game and come out as a loser?
At the end of the day, I get to swim in my own pool of success, knowing that they did not get the chance to fuck me over
So if you tell me that you took advantage of your hard earned skillset, and built a cross platform app(which compiles to native binaries) and sold 2 products for one, I will tell you that you are an excellent player at their game. If you tell me that you finished before and got to charge for 2 weeks of work doing just 2 days I will say that you are an excellent time manager. And if you tell me that at the end of the day you managed to keep said customer I will tell you that you are a true professional.
There is a difference lads, in selling a product to big momma jamma's cajun restaurant, to the largest logistics company around.
Be nice to those that desserve it.6 -
My life could get worse, but it's really shitty now.
Suffering from a serious back injury since last year, my health has been not so positieve lately.
It put a toll on my mood, which in turn asked it's price regarding my relationship. Needless to say that did not go well. Already a fe months single but we kept in touch.
Three days ago my back injury returned, and was unable to lead a normal life. Constant pain, coyld not even move in the house. Even going to the toilet was a terrible experience because when you move, you're in a world of pain.
I asked my ex girlfriend to help me, since she was the only one having a key to my house.
When she arrived i hoped to have some moral support and to help me mive around, ensuring i would not injure myself any more.
Instead i received the cold shoulder. When she wanted to help pe up she did it a bit too hard and the pain sheered thrpughout my body. Screaming in pain.
She promptly left, leaving keys behind.
The hardest part is that she just left without me being able to explain clearly why i screamed. She thought i was yelling at her while in reality i was yelling due to the immense pain.
After that i had to cut ties forever. Tabula rasa. So i removed everything that is related to that time and locked it in my vault.
Since then i can hardly focus, my mibd is numb and i cannot think straight. The alcohol and other sedatives are probably also involved, but still i feel my life is a mountain of depressing shit.
Needed to vent. And yes i post this because i have a need for some understanding, yes for now i crave for some attention and some encouraging, supportive words. I'm left With no other options since the person i wanted it from the most has simply left... And the fact i am unable to actually be social outside...
Fuck friends and relationships, right?13 -
"I'm almost done, I'll just need to add tests!"
Booom! You did it, that was a nuke going off in my head.
No, you shouldn't just need to add tests. The tests should have been written from the get go! You most likely won't cover all the cases. You won't know if adding the tests will break your feature, as you had none, as you refactor your untested mess in order to make your code testable.
When reading your mess of a test case and the painful mocking process you went through, I silently cry out into the void: "Why oh why!? All of this suffering could have been avoided!"
Since most of the time, your mocking pain boils down to not understanding what your "unit" in your "unit test" should be.
So let it be said:
- If you want to build a parser for an XML file, then just write a function / class whose *only* purpose is: parse the XML file, return a value object. That's it. Nothing more, nothing less.
- If you want to build a parser for an XML file, it MUST NOT: download a zip, extract that zip, merge all those files to one big file, parse that big file, talk to some other random APIs as a side-effect, and then return a value object.
Because then you suddenly have to mock away a http service and deal with zip files in your test cases.
The http util of your programming language will most likely work. Your unzip library will most likely work. So just assume it working. There are valid use cases where you want to make sure you acutally send a request and get a response, yet I am talking unit test here only.
In the scope of a class, keep the public methods to a reasonable minimum. As for each public method you shall at least create one test case. If you ever have the feeling "I want to test that private method" replace that statement in your head with: "I should extract that functionality to a new class where that method public. I then can create a unit test case a for that." That new service then becomes a dependency in your current service. Problem solved.
Also, mocking away dependencies should a simple process. If your mocking process fills half the screen, your test setup is overly complicated and your class is doing too much.
That's why I currently dig functional programming so much. When you build pure functions without side effects, unit tests are easy to write. Yet you can apply pure functions to OOP as well (to a degree). Embrace immutability.
Sidenote:
It's really not helpful that a lot of developers don't understand the difference between unit, functional acceptance, integration testing. Then they wonder why they can't test something easily, write overly complex test cases, until someone points out to them: No, in the scope of unit tests, we don't need to test our persistance layer. We just assume that it works. We should only test our businsess logic. You know: "Assuming that I get that response from the database, I expect that to happen." You don't need a test db, make a real query against that, in order to test that. (That still is a valid thing to do. Yet not in the scope of unit tests.)rant developer unit test test testing fp oop writing tests get your shit together unit testing unit tests8 -
This one is more...puzzling than anything else.
We had a consultant come in, a young guy recently out of school. He completed his basic onboarding stuff, got along okay with everyone, etc., but was quiet and kept to himself.
At the end of his first week, we were heading out the door on Friday afternoon, and someone offhandedly said to him “see you next week” or something benign like that. He responded with “yeah we’ll see,” which was...odd.
And then he completely disappeared – we never saw him again.
Okay, so he just decided the job wasn’t for him and quit, right? What’s so strange about that?
Well, for one, the company technically owed him a paycheck for the week, but they couldn’t reach him despite multiple attempts. They eventually left a message and said if you want to get paid, come in and pick up your check. He never did.
But not only that, he *abandoned his car* at the office! On the Friday that he left, he apparently got a ride or a taxi home, and then he just never came back in to get his car. The company eventually had to tow it.
I just would love to know the backstory here. Why would someone go through the trouble to apply for a job, interview, accept the position, work for a week – and then quit without getting paid and leave their car behind??5 -
Boss: this is different from the old console I don't like it
Me: but this has been approved by product management and the team already made estimates and committed to the feature
Boss: Well this needs to change, our existing users will not like it
Me: This is far from agile to be honest, and the change came from user feedback analysis
Boss: You are not doing your work *swears and curses* this is against the team direction!
Me: then why was this committed on this sprint? All I did was facilitate the needs of the team to proceed development.
Boss: *runs out office and starts calling other bosses to boss around*
Runs in 5 minutes later, saying we are not allowed to destroy a feature with enhancements like this.
Me: *Infinite facepalm*7 -
Backstory: Offering manager brings a project through a few months of requirements gathering / feasibility study etc. Project spends 8 months with a R&D team to flesh out. Our team gets 6 months to turn it into a ship able product. 4 months in, offering manager calls a meeting.
OM: ok so you are all working on project X, well I need your input on something
Team: Ok, go ahead
OM: what do you think the app needs to do?
Team: ... I'm sorry?
OM: well we've been looking at it, and we don't think it does very much compared to existing apps. We need a killer feature but we don't know what. Any ideas?
Team: well we were looking at project Y originally, which was a lot more advanced. But you pulled the plug in favour of this.
OM: yeah, believe me customers will want project X a lot more. It just needs to do something interesting ... you know what I mean?
Team: not really, if it doesn't have anything, why did we go for it?
OM: ok I don't think I'm being clear. Point is, if anyone has any ideas let me know, we need to ship it in 2 months and it needs to be killer
I handed in my notice that week and was asked why ... let's just say I told them. -
My first job was actually nontechnical - I was 18 years old and sold premium office furniture for a small store in Munich.
I did code in my free time though (PHP/JS mostly, had a litte browsergame back then - those were the days), so when my boss approached me and asked me whether I liked to take over a coding project, I agreed to the idea.
Little did I know at the time: I was supposed to work with a web agency the boss had contracted to build their online shop. Only that he had no plan or anything, he basically told them "build me an online shop like abc(a major competitor of ours at the time)"
He employed another sales lady who was supposed to manage the shop (that didn't exist yet). In the end, I think 80% of her job was to keep me from killing my boss.
As you can imagine, with this huuuuge amout of planning and these exact visions of what was supposed to be, things went south fast and far. So far that I could visit my fellow flightless birds down in the Penguin's republic of Antarctica and still need to go further.
Well... When my boss started suing the web agency, I was... ahem, asked to take over. Dumb as I was, I did - I was a PHP kid and thought that Magento, being written in PHP, would be easy to master. If you know Magento, you know that was maybe the wrongest thing I ever said.
Fast forward 3 very exhausting months, the thing was online. Not all of it worked yet, but it was online and fairly secure.
I did next to everything myself, administrating the CentOS box the shop was running on, its (own) e-mail server, the web server, all the coding required for the shop (can you spell 12 hour day for 8 hour pay?)
3 further months later, my life basically was a wreck, I dragged myself to work, the only thing I looked forward being the motorcycle ride home. The system worked though.
Mind you, I was still, at the time, working with three major customers, doing deskside support and some admin (Win Server 2008R2 at the time) - because, to quote my boss, "We could not afford a full time developer and we don't need one".
I think i stopped coding in my free time, the one hobby I used to love more than anything on the world, somewhere Decemerish 2012. I dropped out of the open source projects I was in, quit working on my browser game and let everything slide.
I didn't even care to renew the domains and servers for it, I just let it die without notice.
The little free time I had, I spent playing video games and getting drunk/high.
December 2013, 1.5 years on the job, I reached my breaking point and just left, called in sick at least a week per month because I just could not see this fucking place anymore.
I looked for another job outside of ALL of what I did before. No more Magento, no more sales, no more PHP. I didn't have to look for long, despite what I thought of my skills.
In February 2014, I told my boss that I quit. It was still seven months until my new job started, but I wanted him to know early so we could migrate and find a replacement.
The search for said replacement started in June 2014. I had considerably less work in the months before, looks like he got the hint.
In August 2014, my replacement arrived and I got him started.
I found a job, which I am still in, and still happy about after almost half a decade, at a local, medium sized ISP as a software dev and IT security guy. Got a proper training with a certificate and everything now.
My replacement lasted two months, he was external and never really did his job - the site, which until I had quit, had a total of 3 days downtime for 3 YEARS (they were the hoster's fault, not mine), was down for an entire month and he could not even tell why.
HIS followup was kicked after taking two weeks to familiarize himself with the project. Well, I think that two weeks is not even barely enough to familiarize yourself with nearly three years of work, but my boss gave him two days.
In 2016, the shop was replaced with another one. Different shop system, different OS, different CI. I don't know why and I can't say I give a damn.
Almost all the people that worked at the company back with me have left for greener pastures, taking their customers (and revenue) with them.
As for my boss' comments, instructions and lines: THAT might not be safe for work. Or kids. Or humans in general. And there wouldn't be much left if you put it through a language filter...
Moral of the story: No, it's not a bad thing to leave a place if you're mistreated there. Don't mistake loyalty with stupidity!
And, to quote one of my favourite Bands: "Nothing matters when the pain is all but gone" (Tragedy + Time by Rise Against).8 -
Time to rant about JavaScript tutorials.
If you don't know the 'jQuery basic arithmetic' joke, Google it now. It'll make you laugh, promised.
In that manner i just remembered a JavaScript tutorial my fiancee tried to follow when she did an internship at the company i work for last year.
She was tasked to create a temperature interface for our server rack, which she wanted to do via an Arduino and a webserver aswell as an SQL database.
The Arduino part wasn't really a problem, but since she had no experience with js she very closely clinged to a chart visualisation tutorial.
All of that worked very well, but beeing the person i am i looked at the code and found something off.
The chart library had no dependencies to external libraries or any local files for any of them. Though the tutorial used a jQuery import.
So why did it use jQuery?
Well...
To load the chart initialization after the page has loaded.
So they pulled the entirety of jQuery in just to do what fucking window.addEventListener('DOMContentLoaded',function(){...}); could have done.
I wonder how many people who just want something to work did this shit. I hate it that so many tutorials do not adhere any kinds of standards, override behavior because they don't like it, even though it may have a very good reason to exist, pull entire libraries in for something vanilla <language> can do in 3 lines, etc.
Fuck.6 -
Continue of https://devrant.com/rants/2165509/...
So, its been a week since that incident and things were uneventful.
Yesterday, the "Boss" came looking for me...I was working on some legacy code they have.
He asked, "what are you doing ?"
Me, "I am working on the extraction part for module x"
He, "Show me your code!"
Me(😓), shows him.
Then he begins..."Have you even seen production grade code ? What is this naming sense ? (I was using upper and lower camel case for methods and variables)
I said, "sir, this is a naming convention used everywhere"
He, " Why are there so many useless lines in here?"
Me, "Sir, I have been testing with different lines and commenting them out, and mostly they are documentation"
He, "We have separate docs for all, no need to waste your time writing useless things into the code"
Me, 😨, "but how can anyone use my code if I don't comment or document it ?"
He, "We don;t work like that...(basically screaming)..."If you work here you follow the rules. I don't want to hear any excuses, work like you are asked to"
Me, 😡🤯, Okay...nice.
Got up and left.
Mailed him my resignation letter, CCed it to upper management, and right now preparing for an interview on next monday.
When a tech-lead says you should not comment your codes and do not document, you know where your team and the organisation is heading.
Sometimes I wonder how this person made himself a tech-lead and how did this company survived for 7 years!!
I don't know what his problem was with me, I met him for the first time in that office only(not sure if he saw the previous post, I don't care anymore).
Well, whatever, right now I am happy that I left that firm. I wish he get what he deserves.12 -
Me : *trying to download latest version of android studio*
Google: "Your client does not have permission to get URL /studio/index.html from this server. That’s all we know."
Me: FUCK YOU GOOGLE
Me: *googles: دانلود اندروید استودیو* (which means download android studio)
*and downloads it from a random website*
It happens every goddamn time, why the fuck i can't download this shit !? Because these countries are fighting each other all the time! What did i do wrong in my life? I just want to download your fucking app to write another shitty app to continue my fucking life. I don't know shit about this wars happening, I'm just a dev like others all over the world.
Downloading an app, is that too much to ask? Well fuck you then.14 -
Well, for starters there was a cron to restart the webserver every morning.
The product was 10+ years old and written in PHP 5.3 at the time.
Another cron was running every 15 minutes, to "correct" data in the DB. Just regular data, not from an import or something.
Gotta have one of those self-healing systems I guess.
Yet another cron (there where lots) did run everyday from 02:00 to 4ish to generate the newest xlsx report. Almost took out the entire thing every time. MySQL 100%. CPU? Yes. RAM? You bet.
Lucky I wasn't too much involved at the time. But man, that thing was the definition of legacy.
Fun fact: every request was performed twice! First request gave the already logged-in client an unique access-token. Second request then processed the request with the (just issued) access-token; which was then discarded. Security I guess.
I don't know why it was build this way. It just was. I didn't ask. I didn't wanted to know. Some things are better left undisturbed. Just don't anger the machine. I became superstitious for a while. I think, in the end, it help a bit: It feels like communicating with an alien monster but all you have is a trumpet and chewing gum. Gentle does it.
Oh and "Sencha Extjs 3" almost gave me PTSD lol (it's an ancient JS framework). Followed by SOAPs WSDL cache. And a million other things.5 -
Im so frustrated with myself . I've always been afraid of being stupid . Perhaps it was because i was always called the "less intelligent" sibling by my parents . Well i did self-learn java , c++ and android (when i was 15) and made some apps and i did get acknowledged finally but i may have not acknowledged myself . I got into college a couple years ago and i can tell you right out that its like an island filled with stupidity. The teachers , the students. The other day i caught my teacher learning how a transistor works. This is unacceptable for someone who is teaching us advanced op-amps and other circuits . Well , I did get into this college cause it was less tedious and i thought college doesn't matter cause i can self-learn . All i needed was free time . Well college totally destroyed that too and provided no facilities in the process as well . So yeah should i blame my college for my inability to do things the past couple years. I mean i don't think i've learnt a single thing all this while. This is where my frustration begins cause i dont want to blame the college , it's not going to help me and i'll probably end up in a 9 to 5 call center job at this rate . Im also very heavily frustrated with myself , it's like everything i've done so far has been a path of least effort. I have tried a few things which were all just fads like machine learning and crypto and even trading . They felt good and thats what scares me , maybe i don't have the passion and am just looking for a quick buck . This is clearly reflected in the ideas i've been having as well . Well i've never had access to proper funds but now im just trying to justify this layman emotion . I just want to learn and be passionate about learning , researching and i just want enough funds for that . But im afraid , maybe its just that i want to feel superior than my circle . I mean i still don't know why i tried learning rust and wasted even more time setting up fedora and everything around it while i already had a working debian setup and a programming language i'm kind of versed with . i wouldn't say well cause im a self learner and i feel guilty for that . I definitely know i just learnt the surface of the language . Deep down i'm just another stupid fad obsessed guy who feels better by choosing a more complex language that my colleagues look upto . Is this what i am , if so im scared and i don't know what to do . People say that you are what you are and you cant change that . If i cant change this then i dont deserve this wasteful stupid life . I don't know what i should do and it makes me cry . Maybe acknowledging this would've helped but it hasn't , I've felt better playing fortnite rather than learning some basic electronics. Im another one of those aren't I ?17
-
DO !!!NOT!!!!! USE 'X' AND 'P' TO 'CUT AND PASTE' A LOT OF LINES ACROSS FILES IN VIM!!! HOLY SHIT I JUST PWNED MYSELF SO HARD I LOST SO MUCH CODE HOLY FUCK IT'S NOT EVEN FUNNY! WHERE DID AT ALL GO YOU ASK, WHY THE FUCKING REGISTER, OK LET'S CHECK THE REGISTER, COOL THERE IT IS, BUT WAIT, THERE'S ONLY LIKE 20% OF IT BECAUSE WE CUT A SHIT LOAD OF LINES AT ONCE, AND THE REGISTER OVERFILLED.... Ok let's calm down, doesn't Vim have a recovery option? Yes it does, but WAIT A FUCKING MINUTE, MY CHANGES ARE NOT IN THE SWAP FILE BECAUSE IT'S NOT LIKE VIM CRASHED OR ANYTHING, MY DUMB-FUCK-ASS WILLFULLY WROTE THE CHANGES WHEN I SWITCHED OVER TO THE NEW FILE, AND NOW, WELL THAT'S IT, YOU'RE DEAD KIDDO, YOU WROTE THE CHANGES TO DISK, NOTHING YOU CAN DO, AND I AM SO SCREWED I SPECIFICALLY MADE A DEVRANT ACCOUNT TO MAKE SURE NO ONE ELSE PWNS HIMSELF AS HARD AS I JUST DID HOLY FUCK16
-
No one fucking knows how to handle/raise errors.
I feel like this is the least talked topic in all fucking programming industry. This shit needs to be tought even more than the fucking SOLID, DRY, KISS, YAGNI and other kinds of buzzwords that fancy devs love tossing left and right.
Basically everyone just does "whatever you dumb error just dont bother me". They will just log/return null/ignore the errors and be in their oblivion with bugs propagating upstream the call stack.
"Throwing errors you say? Ew, why do you want to produce more errors?". Yeah, right, just stick another log/return null/or ignore the fact that the monke calling your function with bullshit arguments.
"But bro it's so difficult and time consuming and it would never happen!" Yes, you fucker! Yes! Programming IS fucking difficult if you want reliable systems! Did you not know that!? Well now you do! Go and fucking learn it!
FUCK!11!1!!25 -
Girlfriend: How much water did you drink today?
Me: About 3 litres.
Girlfriend: How much of that is coffee?
Me: 5 cups.
Girlfriend: How can you count coffee in that?
Me: Why not?
Girlfriend: It's diuretic.
Me: Yes, but it's still water that goes through my body.
Girlfriend: You're such a smart-ass, huh?
Me: Well, yes, I am.
Girlfriend: So why are you so tired if you think you're drinking enough water? Well?
Me: Never ask a question you don't want to know the answer to.
Girlfriend slammed the door.
So no, women don't want honest men. Guys, lie, lie, lie.
And now I can look at the error message.9 -
Dealing with other technical professionals who cannot think outside their respective boxes.
Here is an example.
A QA (who is very good at her job) said this...
Her:
“We need to get one customer who is willing to pay us a lot of money to make the features they want!”
Me:
“But you realize we are a SaaS company and that means we need lots of customers and constant growth”
Her:
“No, we need to find a customer who is willing to pay us, like a million, to make the features they want. Then we make them for that customer. Then we do that again.”
Me:
“We sell software to small businesses, none of them have a million dollars to pay us, and even if they did then why wouldn’t they build it themselves?
Her:
“Well, when I worked for my last company this is what we did...”
Me:
“So you worked for a contracting company who built software for individual companies. We are not that type of company. We are a SaaS company.”
Her:
“It’s the same thing”
Me:
~Facepalm~
As a software developer and entrepreneur it frustrates me when everyone think everything is the same.
You’ll here things like...
“All we need is to get lucky with one big hit and then we will ride that wave to success, just like Facebook or Amazon!”
Holy fucking shit balls, how stupid can you be!
FB and AZ run thousands of tests a day to see what works. They do not get “lucky”. They dark launched FB messenger with thousands of messages and then rolled it out to their internal team first, they did not get lucky!
Honestly though, I can’t blame them. Most people just want a good job that pays. They aren’t looking to challenge their assumptions.
Personally I know I will be in situations again where my pride, my assumption, my fears are realized and crushed by the market place and I do not want to live in a world of willful ignorance.
I’d rather get it right than feel good.1 -
At one of my former jobs, we devs had to do all sorts of non-dev work, such as writing quotes and even contracts!
The CEO of that company had this naughty habit to contact devs directly without delegating through the CIO. Sure, if it's really urgent like when some system is down because of a bug, go ahead and disturb a dev. But interrupting coders to write some freaking quote? Come on!...
Once, that CEO asked me to stop everything I was doing to write a quote to a customer ASAP, as this was really urgent.
I spent several hours writing that quote. It had to be done right as any specifications in our quotes were used in our agreeements and were referred to in the case of any dispute. So not only were we devs and salesmen in the same time; we also needed to be lawyers.
When I was done and delivered the quote to the CEO, he told me he had no intention to take on that customer in the first place. Instead, he wrote a polite we-are-not-interested e-mail to the customer and cc:d it to me just so that I could read for myself how very sleek a businessman he was.
Me: why did I have to write that quote when you knew all along that you were not going to use it anyway?
Him: It's for your own personal development.
Another naughty habit of that same CEO is that he made "jokes" and remarks that I found inappropriate, such as "You walk like a drunken sailor".
Later, he decided to discontinue our team/product because "it isn't proftable". Well, what do you expect when devs are forced to waste half day completing pointless tasks?!
It was for the better anyway, and I was actually relieved when I left the company. I'm still thinking though, that the real reason he sacked me is that I am too honest and not the docile kind of employee that would be ideal for him. I did question some of my tasks, and worst of all: I didn't laugh at his stupid jokes.1 -
Do you have a ‘Drama Queen’ on your team?
This happened last week.
DK = Drama Queen
DK: “OMG..the link to the document isn’t working! All I get is page not found. I’m supposed to update the notes for this project…and now I can’t! What the _bleep_ and I supposed to do now?!...I don’t understand how …”
This goes on for it seems 5 minutes.
Me: “Hold on...someone probably accidently mistyped the file name or something. I’m sure the document is still there.”
DK: “Well, I’ll never find it. Our intranet is a mess. I’m going to have to tell the PM that the project is delayed now and there is nothing I can do about it because our intranet is such a mess.”
Me: “Maybe, but why don’t you open up the file and see where the reference is?”
DK: “Oh, _bleep_ no…it is HTML…I don’t know anything about HTML. If the company expects me to know HTML, I’m going to have to tell the PM the project is delayed until I take all the courses on W3-Schools.”
Me: “Um…you’ve been developing as long as I have and you have a couple of blogs. You know what an anchor tag is. I don’t think you have to take all those W3 courses. It’s an anchor tag with a wrong HREF, pretty easy to find and fix”
DK: “Umm…I know *my* blog…not this intranet mess. Did you take all the courses on W3-Schools? Do you understand all the latest web html standards?”
Me: “No, but I don’t think W3 has anything to do the problem. Pretty sure I can figure it out.”
DK: “ha ha…’figuring it out’. I have to know every detail on how the intranet works. What about the javascript? Those intranet html files probably have javascript. I can’t make any changes until I know I won’t break anything. _bleep_! Now I have to learn javascript! This C# project will never get done. The PM is going to be _bleep_issed! Great..and I’ll probably have to work weekends to catch up!”
While he is ranting…I open up the html file, locate the misspelling, fix it, save it..
Me: “Hey..it’s fixed. Looks like Karl accidently added a space in the file name. No big deal.”
DK:”What!!! How did you…uh…I don’t understand…how did you know what the file name was? What if you changed something that broke the page? How did you know it was the correct file? I would not change anything unless I understood every detail. You’re gonna’ get fired.”
Me: “Well, it’s done. Move on.”9 -
TL;DR you suck, I suck and everybody sucks, deal with it....
------------------------------------
Let me let off some steam, since I've had enough of people hating on languages "just because"
Every language has it's drawbacks and quirks, BUT they have their strengths also. Saying "I hate {language}" is just you being and ignorant prick and probably your head is so far up your ass that you look like an ass hat. With that being said, every language is either good or bad depending on the developer writing in it. Let's give you an example:
If I ware to give you a brick and ask you to put a nail in a plank, can you do it? Yes, it will be easier if you do it with a hammer, but you have a brick, so hammer is out of the question. If you hit your thumb while doing it... well... sorry, but it is not the bricks fault - it is YOU!
JavaScript, yes it has a whole lot of problems, but it works, you can do a ton of stuff and does a good job at that, it is evolving through node and typescript (and others, just a personal pref), BUT if you used js when you ware debugging that jquery (1.0) plugin written in the free time of a 13 yo, who copy pasted a bunch from SO, well, it is not js' problem - deal with it. Same goes for PHP, i've been there where you had a single `index.php` with bazillion lines of code, did a bunch of eval and it was called MVC, but it also is evolving.. thing is all languages allow you to do some dumb stuff so YOU have to be responsible to not fuck it up (which you always DO btw, we all do). Difference is PHP/JS roll with it because the assumption is that you know what you are doing, which again - newsflash - you don't.
More or less I would blame that shit on businesses which decided to go with undergrads to save money instead of investing in their product, hell, I am in a major company that does not invest that doesn't care a whole lot about dev /tech stuff and now everybody's mother is an engineer - they care about money, because investors care about money (ROI) and because clean code does not pay the bills, but money does.
If we get all of the good practices and apply them to each language every one of them has it's place, that is why there is no "The Language", even if there was, we STILL ware going to fuck it up and probably it was going to be even worse than where we are now.
Study, improve, rinse and repeat... There are SENIORS and LEADS out there that are about 25-30 and have no fucking clue about the language, because they have stuck up their heads up the ass of frameworks and refuse to take a breath of clean air and consider something different than their dogmatic framework "way" of doing things.. That is the result you are seeing. Let me give you a fresh example to illustrate where I am at atm:
Le me works with ZendFramework 2.3-2.5 (why not, which is PHP5+ running on PHP7 [fancy, eh]), and little me writes a module for said project, and tries to contain it in its own space, i.e not touching anything outside of the folder of the module so it is SELF-CONTAINED (see, practices), during 2-3-4 iterations of code review, I've had to modify 4 different modules with `if (somthing === self::SOMETHING_TYPE)` as requested by my TL, which resulted in me not covering 3 use-cases after the changes and not adding a new event (the fw is event-driven, cuz.. reasons) so I have to use a bunch of ifs in the code, to check a config value and do shit. That is the way of I am asked to do things I hate what I've done and the fact that because of CR I have lost case-coverage, a week of work and the same TL will be on my ass on monday that things are now "perfect".
The biggest things is "we care about convention and code style"... right.... That is not because of the language, not because of me, not because of the framework - it is some dude's opinion that you hate, not the language.
New stuff are better, reinventing the wheel is also good, if it wasn't you would've had a few stone circular things on your car and things ware going to be like that - we need to try and try, that is the only way we actually learn shit.
Until things change in the trade, we will be on the same boat, complaining about the same shit over and over, you and me won't be alive probably but things will not change a bit.
We live in a place where state is considered good, god objects necessary (can you believe it, I've got kudos for using the term 'God Object'... yep, let that sink in). If you really hate something, please, oh god I beg you, show me how you will do it better and I will shake your hand and buy you a beer, but until then, please keep your ass-hurt fanboy opinion to your self, no one gives a shit about what you think, we will die and the world will not notice...6 -
TL; DR: Bringing up quantum computing is going to be the next catchall for everything and I'm already fucking sick of it.
Actual convo i had:
"You should really secure your AWS instance."
"Isnt my SSH key alone a good enough barrier?"
"There are hundreds of thousands of incidents where people either get hacked or commit it to github."
"Well i wont"
"Just start using IP/CIDR based filtering, or i will take your instance down."
"But SSH keys are going to be useless in a couple years due to QUANTUM FUCKING COMPUTING, so why wouldnt IP spoofing get even better?"
"Listen motherfucker, i may actually kill you, because today i dont have time for this. The whole point of IP-based security is that you cant look on Shodan for machines with open SSH ports. You want to talk about quantum computing??!! Lets fucking roll motherfucker. I dont think it will be in the next thousand years that we will even come close to fault-tolerant quantum computing.
And even if it did, there have been vulnerabilities in SSH before. How often do you update your instance? I can see the uptime is 395 days, so probably not fucking often! I bet you "dont have anything important anyways" on there! No stored passwords, no stored keys, no nothing, right (she absolutely did)? If you actually think I'm going to back down on this when i sit in the same room as the dude with the root keys to our account, you can kindly take your keyboard and shove it up your ass.
Christ, I bet that the reason you like quantum computing so much is because then you'll be able to get your deepfakes of miley cyrus easier you perv."8 -
Damn senior guy from storage background worked for a big company, he wants to learn git and so I told him to install git from git scm portal.
Well he did and came back saying its not working. I wondered thats not possible to curiousity I when to.his desk and found he was using fucking windows xp sp3 on his laptop.
I told him can you install windows 10
Well he tried but his fucking hardware doesnt support.
Wondered seriously why on earth this guy still using windows xp7 -
So recently I did a lot of research into the internals of Computers and CPUs.
And i'd like to share a result of mine.
First of all, take some time to look at the code down below. You see two assembler codes and two command lines.
The Assembler code is designed to test how the instructions "enter" and "leave" compare to manually doing what they are shortened to.
Enter and leave create a new Stackframe: this means, that they create a new temporary stack. The stack is where local variables are put to by the compiler. On the right side, you can see how I create my own stack by using
push rbp
mov rbp, rsp
sub rsp, 0
(I won't get into details behind why that works).
Okay. Why is this even relevant?
Well: there is the assumption that enter and leave are very slow. This is due to raw numbers:
In some paper I saw ( I couldn't find the link, i'm sorry), enter was said to use up 12 CPU cycles, while the manual stacking would require 3 (push + mov + sub => 1 + 1 + 1).
When I compile an empty function, I get pretty much what you'd expect just from the raw numbers of CPU cycles.
HOWEVER, then I add the dummy code in the middle:
mov eax, 123
add eax, 123543
mov ebx, 234
div ebx
and magically - both sides have the same result.
Why????
For one thing, there is CPU prefetching. This is the CPU loading in ram before its done executing the current instruction (this is how anti-debugger code works, btw. Might make another rant on that). Then there is the fact that the CPU usually starts work on the next instruction while the current instruction is processing IFF the register currently involved isnt involved in the next instruction (that would cause a lot of synchronisation problems). Now notice, that the CPU can't do any of that when manually entering and leaving. It can only start doing the mov eax, 1234 while performing the sub rsp, 0.
----------------
NOW: notice that the code on the right didn't take any precautions like making sure that the stack is big enough. If you sub too much stack at once, the stack will be exhausted, thats what we call a stack overflow. enter implements checks for that, and emits an interrupt if there is a SO (take this with a grain of salt, I couldn't find a resource backing this up). There are another type of checks I don't fully get (stack level checks) so I'd rather not make a fool of myself by writing about them.
Because of all those reasons I think that compilers should start using enter and leave again.
========
This post showed very well that bare numbers can often mislead.21 -
- Back in October 2019 -
- Me: Hey, these two servers are having weird problems. Several services we use stop functioning every 7-10 days. I can temporarily fix them by taking them off the domain and putting them back on, but I don’t know why they’re happening or what further damage this workaround causes.
- Boss: Thats not good. Well. Keep doing the fix when it’s needed.
- Me: We should really reach out to someone at Microsoft through our support plan. I have no idea how to fix any of this and it’s making our Hyper-V environment very unstable.
- Boss: K. Let’s not worry about that now, let’s just keep working around it.
- In January 2020 -
- Me: Hey boss. More and more errors are generating from these servers. I’ve created a log of everything Ive found to hand off to a support agent. We really need to.
- Boss: Okay. Let’s talk to our internal team that uses Hyper-V and see what they did since they don’t have any problems.
- Me: Its not Hyper-V specific. It’s stemming from AD and authentication. It causes problems even without Hyper-V installed, so I don’t think it will help.
- Boss: K. Let’s just do what we can with what we got.
- Today, May 2020 -
- Me: Hey. The servers no longer work at all, and the workaround has no effect anymore. I’m completely stalled on my project now and have nothing to do.
- Boss: What?? What happened to them?
- Me: *Sends 17 page PDF file documenting all found issues, errors, warnings, and weird anomalies in both servers, as well as troubleshooting steps I’ve already performed*
- Boss: None of this makes any sense. I need you to start troubleshooting right away.
- Me: But... I can’t... *Sends screenshots of errors having no search results on the web, screenshots of Microsoft Support Techs on forums telling me we need to open tickets with Microsoft directly, other reasons why I’m completely blocked*
- Boss: Keep trying to figure it out. We need this resolved as soon as possible and we can’t let it happen again in the future.
Now I’m completely alone in our office, bitterly staring at the servers, trying to force an epiphany on how to fix these dumb boxes.5 -
I AM TIRED
warning: this rant is going to be full of negativity , CAPS, and cursing.
People always think and they always write that programming is an analytical profession. IF YOU CANNOT THINK IN AN ANALYTICAL WAY THIS JOB IS NOT FOR YOU! But the reality could not be farther from the truth.
A LOT of people in this field whether they're technical people or otherwise, just lack any kind of reasoning or "ANALYTICAL" thinking skills. If anything, a lot of of them are delusional and/or they just care about looking COOL. "Because programming is like getting paid to solve puzzles" *insert stupid retarded laugh here*.
A lot of devs out there just read a book or two and read a Medium article by another wannabe, now think they're hot shit. They know what they're doing. They're the gods of "clean" and "modular" design and all companies should be in AWE of their skills paralleled only by those of deities!
Everyone out there and their Neanderthal ancestor from start-up founders to developers think they're the next Google/Amazon/Facebook/*insert fancy shitty tech company*.
Founder? THEY WANT TO MOVE FAST AND GET TO MARKET FAST WITH STUPID DEADLINES! even if it's not necessary. Why? BECAUSE YOU INFERIOR DEVELOPER HAVE NOT READ THE STUPID HOT PILE OF GARBAGE I READ ONLINE BY THE POEPLE I BLINDLY COPY! "IF YOU'RE NOT EMBARRASSED BY THE FIRST VERSION OF YOU APP, YOU DID SOMETHING WRONG" - someone at Amazon.
Well you delusional brainless piece of stupidity, YOU ARE NOT AMAZON. THE FIRST VERSION THAT THIS AMAZON FOUNDER IS EMBARRASSED ABOUT IS WHAT YOU JERK OFF TO AT NIGHT! IT IS WHAT YOU DREAM ABOUT HAVING!
And oh let's not forget the tech stacks that make absolutely no fucking sense and are just a pile of glue and abstraction levels on top of abstraction levels that are being used everywhere. Why? BECAUSE GOOGLE DOES IT THAT WAY DUH!! And when Google (or any other fancy shit company) changes it, the old shitty tech stack that by some miracle you got to work and everyone is writing in, is now all of a sudden OBSOLETE! IT IS OLD. NO ONE IS WRITING SHIT IN THAT ANYMORE!
And oh my god do I get a PTSD every time I hear a stupid fucker saying shit like "clean architecture" "clean shit" "best practice". Because I have yet to see someone whose sentences HAVE TO HAVE one of these words in them, that actually writes anything decent. They say this shit because of some garbage article they read online and in reality when you look at their code it is hot heap of horseshit after eating something rancid. NOTHING IS CLEAN ABOUT IT. NOTHING IS DONE RIGHT. AND OH GOD IF THAT PERSON WAS YOUR TECH MANAGER AND YOU HAVE TO LISTEN TO THEM RUNNING THEIR SHITHOLE ABOUT HOW YOUR SIMPLE CODE IS "NOT CLEAN". And when you think that there might be a valid reason to why they're doing things that way, you get an answer of someone in an interview who's been asked about something they don't know, but they're trying to BS their way to sounding smart and knowledgable. 0 logic 0 reason 0 brain.
Let me give you a couple of examples from my unfortunate encounters in the land of the delusional.
I was working at this start up which is fairly successful and there was this guy responsible for developing the front-end of their website using ReactJS and they're using Redux (WHOSE SOLE PURPOSE IS TO ELIMINATE PASSING ATTRIBUTES FOR THE PURPOSE OF PASSING THEM DOWN THE COMPONENT HIERARCHY AGIAN). This guy kept ranting about their quality and their shit every single time we had a conversation about the code while I was getting to know everything. Also keep in mind he was the one who decided to use Redux. Low and behold there was this component which has THIRTY MOTHERFUCKING SEVEN PROPERTIES WHOSE SOLE PURPOSE IS BE PASSED DOWN AGAIN LIKE 3 TO 4 TIMES!.
This stupid shit kept telling me to write code in a "functional" style. AND ALL HE KNOWS ABOUT FUNCTIONAL PROGRAMMING IS USING MAP, FILTER, REDUCE! And says shit like "WE DONT NEED UNIT TESTS BECAUSE FUNCTIONAL PROGRAMMING HAS NO ERRORS!" Later on I found that he read a book about functional programming in JS and now he fucking thinks he knows what functional programming is! Oh I forgot to mention that the body of his "maps" is like 70 fucking lines of code!
Another fin-tech company I worked at had a quote from Machiavelli's The Prince on EACH FUCKING DESK:
"There is nothing more difficult to take in hand, more perilous to conduct, or more uncertain in its success, than to take the lead in the introduction of a new order of things."
MOTHERFUCKER! NEW ORDER OF THINGS? THERE 10 OTHER COMPANIES DOING THE SAME SHIT ALREADY!
And the one that got on my nerves as a space lover. Is a quote from Kennedy's speech about going to the moon in the 60s "We choose to go to the moon and do the hard things ..."
YOU FUCKING DELUSIONAL CUNT! YOU THINK BUILDING YOUR SHITTY COPY PASTED START UP IS COMPARABLE TO GOING TO THE MOON IN THE 60S?
I am just tired of all those fuckers.13 -
oh, it got better!
One year ago I got fed up with my daily chores at work and decided to build a robot that does them, and does them better and with higher accuracy than I could ever do (or either of my teammates). So I did it. And since it was my personal initiative, I wasn't given any spare time to work on it. So that leaves gaps between my BAU tasks and personal time after working hours.
Regardless, I spent countless hours building the thing. It's not very large, ~50k LoC, but for a single person with very little time, it's quite a project to make.
The result is a pure-Java slack-bot and a REST API that's utilized by the bot. The bot knows how to parse natural language, how to reply responses in human-friendly format and how to shout out errors in human-friendly manner. Also supports conversation contexts (e.g. asks for additional details if needed before starting some task), and some other bells and whistles. It's a pretty cool automaton with a human-friendly human-like UI.
A year goes by. Management decides that another team should take this project over. Well okay, they are the client, the code is technically theirs.
The team asks me to do the knowledge transfer. Sounds reasonable. Okay.. I'll do it. It's my baby, you are taking it over - sure, I'll teach you how to have fun with it.
Then they announce they will want to port this codebase to use an excessive, completely rudimentary framework (in this project) and hog of resources - Spring. I was startled... They have a perfectly running lightweight pure-java solution, suitable for lambdas (starts up in 0.3sec), having complete control over all the parts of the machinery. And they want to turn it into a clunky, slow monster, riddled with Reflection, limited by the framework, allowing (and often encouraging) bad coding practices.
When I asked "what problem does this codebase have that Spring is going to solve" they replied me with "none, it's just that we're more used to maintaining Spring projects"
sure... why not... My baby is too pretty and too powerful for you - make it disgusting first thing in the morning! You own it anyway..
Then I am asked to consult them on how is it best to make the port. How to destroy my perfectly isolated handlers and merge them into monstrous @Controller classes with shared contexts and stuff. So you not only want to kill my baby - you want me to advise you on how to do it best.
sure... why not...
I did what I was asked until they ran into classloader conflicts (Spring context has its own classloaders). A few months later the port is not yet complete - the Spring version does not boot up. And they accidentally mention that a demo is coming. They'll be demoing that degenerate abomination to the VP.
The port was far from ready, so they were going to use my original version. And once again they asked me "what do you think we should show in the demo?"
You took my baby. You want to mutilate it. You want me to advise on how to do that best. And now you want me to advise on "which angle would it be best to look at it".
I wasn't invited to the demo, but my colleagues were. After the demo they told me mgmt asked those devs "why are you porting it to Spring?" and they answered with "because Spring will open us lots of possibilities for maintenance and extension of this project"
That hurts.
I can take a lot. But man, that hurts.
I wonder what else have they planned for me...rant slack idiocy project takeover automation hurts bot frameworks poor decision spring mutilation java9 -
sooooooooo for my current graduate class we were to use the MVC pattern to build an IOS application(they preferred it if we did an IOS application) or if you didn't have an Apple computer: an Android application.
The thing is, they specified to use Java, while in their lectures and demos they made a lot of points for other technologies, hybrid technologies, such as React Cordova, all that shit, they even mentioned React Native and more. But not one single mention of Kotlin. Last time I tried my hand at Android development was way before Kotlin, it was actually my first major development job: Mobile development, for which we used Obj C on the IOS part and well, Java on the Android part.
As some of you might now, I rarely have something bad to say about a tech stack(except for VBA which I despise, but I digress) and I love and use Java at work. But the Android API has always seem unnecessarily complex for my taste, because of that, when I was working as a mobile development I dreaded every single minute in which I had to code for Android, Google had a great way to make people despise Java through their Android API. I am not saying it is shit, I am not saying it is bad, I just-dont-like-it.
Kotlin, proves a superior choice in my humble opinion for Android development, and because the language is for retards, it was fairly easy for me to pick it up in about 2 hours. I was already redesigning some of my largest Spring applications using half the code and implemented about 80% of the application's functionality in less than 3 hours(login, fragment manipulation, permissions, bla bla) and by that time I started to wonder if the app built on Kotlin would be ok. And why not? If they specifically mentioned and demonstrated examples using Swift, then surely Kotlin would be fine no? Between Kotlin and Java it is easy to see that kotlin is more similar to Swift than Java. So I sent an email. Their response: "I am sorry, but we would much rather you stick with the official implementations for Android, which in this case is Java for the development of the application"
I was like 0.o wat? So I replied back sending links and documentation where Google touted Kotlin as the new and preferred way to develop Android applications, not as a second class citizen of the platform, but as THE preferred stack. Same response.
Eventually one of the instructors reflected long enough on it to say that it was fine if I developed the application in Kotlin, but they advised me that since they already had grading criteria for the Java program I had to redo it in Java. It did not took me long really, once I was finished with the Kotlin application I basically rewrote only a couple of things into Java.
The end result? I think that for Android I still greatly prefer Kotlin. Even though I am not the biggest fan of Kotlin for anything else, or as my preferred language in the JVM.
I just.......wish....they would have said something along the lines of: "Nah fam please rewrite that shit for Java since we don't have grading criterias in place for Kotlin, sorry bruh, 10/10 gg tho" instead of them getting into an email battle with me concerning Kotlin being or not being the language to use in Android. It made me feel that they effectively had no clue what they were talking about and as such not really capable of taking care of students on a graduate level program.
Made me feel dirty.12 -
So... did I mention I sometimes hate banks?
But I'll start at the beginning.
In the beginning, the big bang created the universe and evolution created humans, penguins, polar bea... oh well, fuck it, a couple million years fast forward...
Your trusted, local flightless bird walks into a bank to open an account. This, on its own, was a mistake, but opening an online bank account as a minor (which I was before I turned 18, because that was how things worked) was not that easy at the time.
So, yours truly of course signs a contract, binding me to follow the BSI Grundschutz (A basic security standard in Germany, it's not a law, but part of some contracts. It contains basic security advice like "don't run unknown software, install antivirus/firewall, use strong passwords", so it's just a basic prototype for a security policy).
The copy provided with my contract states a minimum password length of 8 (somewhat reasonable if you don't limit yourself to alphanumeric, include the entire UTF 8 standard and so on).
The bank's online banking password length is limited to 5 characters. So... fuck the contract, huh?
Calling support, they claimed that it is a "technical neccessity" (I never state my job when calling a support line. The more skilled people on the other hand notice it sooner or later, the others - why bother telling them) and that it is "stored encrypted". Why they use a nonstandard way of storing and encrypting it and making it that easy to brute-force it... no idea.
However, after three login attempts, the account is blocked, so a brute force attack turns into a DOS attack.
And since the only way to unblock it is to physically appear in a branch, you just would need to hit a couple thousand accounts in a neighbourhood (not a lot if you use bots and know a thing or two about the syntax of IBAN numbers) and fill up all the branches with lots of potential hostages for your planned heist or terrorist attack. Quite useful.
So, after getting nowhere with the support - After suggesting to change my username to something cryptic and insisting that their homegrown, 2FA would prevent attacks. Unless someone would login (which worked without 2FA because the 2FA only is used when moving money), report the card missing, request a new one to a different address and log in with that. Which, you know, is quite likely to happen and be blamed on the customer.
So... I went to cancel my account there - seeing as I could not fulfill my contract as a customer. I've signed to use a minimum password length of 8. I can only use a password length of 5.
Contract void. Sometimes, I love dealing with idiots.
And these people are in charge of billions of money, stock and assets. I think I'll move to... idk, Antarctica?4 -
Not about favorite language but about why PHP is not my favorite language.
I recently launched a web shop built on Prestashop. I found that some product pages are so god damn slow, like taking 50 fuckin' seconds to load. So I started investigating and analyzing the problem. Turns out that for some products we have so many different combinations that it results in a cartesian product totalling about 75K of unique combinations.
Prestashop did a real bad job coding the product controller because for every combination they fetch additional data. So that results in 75K queries being executed for just 1 product detail page. Crazy, even more when you know that the query that loads all these combinations, before iterating through them, takes 7 fuckin' seconds to execute on my dev machine which is a very very fast high end machine.
That said I analyzed the query and now I broke the query down into 3 smaller queries that execute in a much faster 400 ms (in total!) fetching the exact same data.
So what does this have to do with PHP? As PHP is also OO why the fuck would you always put stuff in these god damn associative arrays, that in turn contain associative arrays that contain more arrays containing even more arrays of arrays.
Yes I could do the same in C# and other languages as well but I have never ever encountered that in other languages but always seem to find this in PHP. That's why I hate PHP. Not because of the language but all those fucking retarded assholes putting everything in arrays. Nothing OO about that.2 -
A while back I took over responsibility for getting one of our developers up to speed, after the other guy basically gave up on him.
Management insisted that this new recruit was our guy. I was kind of going along, since I had been there during the recruits first meeting with us, and he seemed to know his stuff.
I was very wrong. He was suppose to have been working with kubernetes, but suddenly did not know what a container was. After explaining it to him, he said along the lines of “yeah, sure, I was only testing you, I know all about this”.
He did the same thing for a number of other technologies. Always said that he knew very well what it was, and that I did not need to teach him those things.
Yet, he always seemed to get stuck with basic stuff, like installing node, setting up env-vars, starting docker-containers locally and that sort of things.
I mean, it is perfectly fine to say that you don’t know. I even consider it a great answer; it shows honesty and makes me trust you more. But with this guy, it was just impossible to get him up and running, since he always “knew”, but yet always needed help.
We had to let him go. Since I had been the one who had spent most time with him, it was natural that I was to be the one to tell him. I was not looking forward to it, I’m not reallly a persons-guy. Still, I was calm and honest with him and basically told him that I had found it impossible to work with him, kind of harshly.
He then asked me if he could put me on as a reference for his future job-applications. I told him politely that I did not think that was a great idea. He asked why, I told him I would be unable to say anything that would benefit him. He then asked me to lie.
I didn’t know what to say, except for “no!”. Never saw him again after that.3 -
This is a story of suffering and despair.
I'm working on a build system for our firmware. Nothing major, just a cmake script to build everything and give me an elf file.
I'm fairly new to cmake at that point, and so it's not abundantly clear to me how the `addDirectory` command works.
Now those of you with experience in cmake will say:
"Hold on there champ, this is not a cmake command, the real thing is add_subdirectory()"
Well, that is not what chatGPT told me. I still trusted the fucking thing at this point, it explained that it was in fact a command, and that it added all subsequent source files from a given folder. When I asked it to provide me with sources, it gave me a dead link in a cmake dot com subdomain.
I spent FUCKING HOURS trying to understand why I couldn't find that shitty command, I looked through that shitty page they call documentation through and through, I fucking checked previous and nightly versions, the command was nowhere to be found.
Until I found an old as time post in stackOverflow...
Someone had made a macro with that name, that did what GPT had described...
On the positive side, I know cmake now. I also don't use this fucking deep Learning piece of shit. Unless you write simple JS or blinking LEDs with Arduino it codes like a Junior, high on every kind of glue on the market.11 -
Send over the entire directory for a WordPress site we completely overhauled with new plugins, custom theme, redid content with visual composer, etc. I tell him to backup his site and then put everything I give you as fresh. He tells me he can't just wipe out his entire site that's unacceptable. I ask him what's the problem? he rambles on and says a lot of words that don't really mean anything then says security. so I call him out on it, what security issues do you have? well we have users and permissions setup he says. I explain That I copied his users table over when we did the redesign, so it's the exact same stuff. so I say again, why can't we just replace everything? well that's just not acceptable he says. I ask him again, what EXACTLY is your problem with replacing the site since I already addressed your security concern. he couldn't answer me so now we have another conference call tomorrow morning with more people from their team. I'll let you know how it goes.
tldr; clients are idiots, call them out for the dumb shit they say and have no response.7 -
Just in case you thought you and your tech job were weird I give you:
Herpetologist: I caught a turtle here in Costa Rica.
Camera man: Cool. What kind is it?
H: this is the white eared red footed mud guppy. See what's interesting is that it has white sides of its face. And red feet. And lives in Costa Rica. In the mud. It is not a guppy though. Guppies are fish.
C: Cool and why is it important?
H: It's a white eared red footed mud guppy.
C: what does it do?
H: It's a turtle.
C: yeah but is it endangered? Venomous?
H: Nope. Just a regular old turtle.
C: so you just ran 50 miles and dove in to a random body of water that probably contained malaria and herpes to catch a regular turtle.
H: well it's not a regular turtle
C:(glares) it isn't?
H: it is. But it's a white eared red footed mud guppy.
C: so why did you catch it?
H: I like turtles.
So look at it this way: you could be the camera man.2 -
Consumers ruined software development and we the developers have little to no chance of changing it.
Recently I read a great blog post by someone called Nikita, the blog post talks mostly about the lack of efficiency and waste of resources modern software has and even tho I agree with the sentiment I don't agree with some things.
First of all the way the author compares software engineering to mechanical, civil and aeroespacial engineering is flawed, why? Because they all directly impact the average consumer more than laggy chrome.
Do you know why car engines have reached such high efficiency numbers? Gas prices keep increasing, why is building a skyscraper better, cheaper and safer than before? Consumers want cheaper and safer buildings, why are airplanes so carefully engineered? Consumers want safer and cheaper flights.
Wanna know what the average software consumer wants? Shiny "beautiful" software that is either dirt ship or free and does what it needs to. The difference between our end product is that average consumers DON'T see the end product, they just experience the light, intuitive experience we are demanded to provide! It's not for nothing that the stereotype of "wizard" still exists, for the average folk magic and electricity makes their devices function and we are to blame, we did our jobs TOO well!
Don't get me wrong, I am about to become a software engineer and efficient, elegant, quality code is the second best eye candy next to a 21yo LA model. BUT dirt cheap software doesn't mean quality software, software developed in a hurry is not quality software and that's what douchebag bosses and consumers demand! They want it cheap, they want it shiny and they wanted it yesterday!
Just look at where the actual effort is going, devs focus on delivering half baked solutions on time just to "harden" the software later and I don't blame them, complete, quality, efficient solutions take time and effort and that costs money, money companies and users don't want to invest most of the time. Who gets to worry about efficiency and ms speed gains? Big ass companies where every second counts because it directly affects their bottom line.
People don't give a shit and it sucks but they forfeit the right to complain the moment they start screaming about the buttons not glaring when hovered upon rather than the 60sec bootup, actual efforts to make quality software are made on people's own time or time critical projects.
You put up a nice example with the python tweet snippet, you have a python script that runs everyday and takes 1.6 seconds, what if I told you I'll pay you 50 cents for you to translate it to Rust and it takes you 6 hours or better what if you do it for free?
The answer to that sort of questions is given every day when "enganeers" across the lake claim to make you an Uber app for 100 bucks in 5 days, people just don't care, we do and that's why developers often end up with the fancy stuff and creating startups from the ground up, they put in the effort and they are compensated for it.
I agree things will get better, things are getting better and we are working to make programs and systems more efficient (specially in the Open Source community or high end Tech companies) but unless consumers and university teachers change their mindset not much can be done about the regular folk.
For now my mother doesn't care if her Android phone takes too much time to turn on as long as it runs Candy Crush just fine. On my part I'll keep programming the best I can, optimizing the best I can for my own projects and others because that's just how I roll, but if I'm hungry I won't hesitate to give you the performance you pay for.
Source:
http://tonsky.me/blog/...13 -
This was some time ago. A Legendary bug appeared. It worked in the dev environment, but not in the test and production environment.
It had been a week since I was working on the issue. I couldn't pinpoint the problem. We CANNOT change the code that was already there, so we needed to override the code that was written. As I was going at it, something happened.
---
Manager: "Hey, it's working now. What did you do?"
Me: *Very confused because I know I was nowhere close to finding the real source of the problem* Oh, it is? Let me check.
Also me: *Goes and check on the test and prod environment and indeed, it's already working*
Also me to the power of three: *Contemplates on life, the meaning of it, of why I am here, who's going to throw out the trash later, asking myself whether my buddies and I will be drinking tonight, only to realize that I am still on the phone with my manager*
Me again: "Oh wow, it's working."
Manager: "Great job. What were the changes in the code?"
Me: "All I did was put console logs and pushed the changes to test and prod if they were producing the same log results."
Manager: "So there were no changes whatsoever, is that what you mean?"
Me: "Yep. I've no idea why it just suddenly worked."
Manager: "Well, as long as it's working! Just remove those logs and deploy them again to the test and prod environment and add 'Test and prod fix' to the commit comment."
Me: "But what if the problem comes up again? I mean technically we haven't resolved the issue. The only change I made were like 20 lines of console logs! "
Manager: "It's working, isn't it? If it becomes a problem, we'll work it out later."
---
I did as I was told, and Lo and Behold, the problem never occurred again.
Was the system playing a joke on me? The system probably felt sorry for me and thought, "Look at this poor fucker, having such a hard time on a problem he can't even comprehend. That idiotic programmer had so many sleepless nights and yet still couldn't find the solution. Guess I gotta do my job and fix it for him. I'm the only one doing the work around here. Pathetic Homo sapiens!"
Don't get me wrong, I'm glad that it's over but..
What the fuck happened?5 -
How can some developers send emails like "I did <x> and <y> right, but I still have an error!" with NO copy/paste of the error? Come on, you hate user emails that just say "Your site doesn't work." You should know better.
I'm going to just start answering with "Wow, that sucks, and you did everything right, huh? It must just hate you." I shouldn't have to go force you to tell me what the problem actually is at that basic level.
I used to think this was a user thing. We wouldn't do that... hah, lost user, oh well, that's why we're helping them. Apparently it's not.6 -
I had spent the last year working on a online store power by woocommerce with over 100k products from various suppliers. This online store utilized a custom API that would take the various formats that suppliers offer their inventory in and made them consistent. Now everything was going swimmingly initially, but then I began adding more and more products using a plug-in called WP all import. I reached around 100k products and the site would take up to an entire minute to load sometimes timing out. I got desperate so I installed several caching plugins, but to no avail this did not help me. The site was originally only supposed to take three to four months but ended up taking an entire year. Then, just yesterday I found out what went wrong and why this woocommerce website with all of these optimizations was still taking anywhere from 60 to 90 seconds to load, or just timing out entirely. I had initially thought that I needed a beefier server so I moved it to a high CPU digitalocean VM. While this did help a little bit, the site was still very slow and now I had very high CPU usage RAM usage and high disk IO. I was seriously stumped the Apache process was using a high amount of CPU and IO along with MYSQL as well. It wasn't until I started digging deeper into the database that I actually found out what the issue was. As I was loading the site I would run 'show process list' in the SQL terminal, I began to notice a very significant load time for one of the tables, so I went to go and check it out. What I did was I ran a select all query on that particular table just to see how full it was and SQL returned a error saying that I had exceeded the maximum packet size. So I was like okay what the fuck...
So I exited my SQL and re-entered it this time with a higher packet size. I ran a query that would count how many rows were in this particular table and the number came out to being in the millions. I was surprised, and what's worse is that this table belong to a plugin that I had attempted to use early in the development process to cache the site. The plugin was deactivated but apparently it had left PHP files within the wp content directory outside of the actual plugin directory, so it's still executing scripts even though the plugin itself was disabled. Basically every time I would change anything on the site, it would recache the whole thing, and it didn't delete any old records. So 100k+ products caching on saves with no garbage collection... You do the math, it's gonna be a heavy ass database. Not only that but it was serialized data, so when it did pull this metric shit ton of spaghetti from the database, PHP then had to deserialize it. Hence the high ass CPU load. I had caching enabled on the MySQL end of things so that ate the ram. I was really desperate to get this thing running.
Honest to God the main reason why this website took so long was because the load times made it miserable to work on. I just thought that the hardware that I had the site on was inadequate. I had initially started the development on a small Linux VM which apparently wasn't enough, which is why I moved it to digitalocean which also seemed to not be enough, so from there I moved to a dedicated server which still didn't seem to be enough. I was probably a few more 60-second wait times or timeouts from recommending a server cluster to my client who I know would not be willing to purchase it. The client who I promised this site to have completed in 3 months and has waited a year. Seriously, I would tell people the struggles that I would go through with this particular site and they would just tell me to just drop the site; just take the money, just take the loss. I refused to, this was really the only thing that was kicking my ass. I present myself as this high-and-mighty developer like I'm just really good at what I do but then I have this WordPress site that's just beating the shit out of me for a year. It was a very big learning experience and it was also very humbling as well, it made me realize that I really don't know as much as I think I might. It was evidence that there is still so much more to learn out there, I did learn a lot from that experience especially about optimizing websites the different types of methods to do that particular lonely on the server side and I'll be able to utilize this knowledge in the future.
I guess the moral of the story is, never really give up. Ultimately things might get so bad that you're running on hopes and dreams. Those experiences are generally the most humbling. Now I can finally present the site that I am basically a year late on to the client who will be so happy that I did not give up on the project entirely. I'll have experienced this feeling of pure euphoria, and help the small business significantly grow their revenue. Helping others is very fulfilling for me, even at my own expense.
Anyways, gonna stop ranting. Running out of characters. If you're still here... Ty for reading :')7 -
Working with a client on his "superior idea" and suddenly this happens: (longer rant)
tl;dr;
Client wanted me to move a div by 3 millimetres to the left and blamed me for not being capable of doing so while giving him a nonsense about different resolutions and screen sizes. (Use a ruler, DUH)
Me: Here's the updated design layout as our designer specified.
Him: Looks good but it needs to be moved 3 millimetres to the left
Me: *Confused as hell* - Wait, did you just said 3 millimetres?
Him: Yes, is that a problem for you?
Me: *Amazed* Well, yes, you see, we don't measure in millimetres. We use pixels.
Him: Ahh, can't you do anything right!? Why do I have to deal with your nonsense of telling me that this is not impossible? Just take your god damn ruler and put it on your screen, then move it 3 millimetres to the left.
Me: You do realise that every person has a different size/resolution monitor so it won't work?
Him: I don't care. Just do your god damn job or i'll find someone else to do it.
*
Story continued in such manner - we spent an hour on skype moving the stupid <div> around until it hit his 3 millimetres mark.
*
His: See, you could do it.
Me: *Sends him screenshot of my own screen (his was 1024x768, mine 1920x1080) where page is broken and not aligned*
Him: Oh come on, you break every god damn thing. You are the worst. I'm going to find a better one. *hangs skype call*
Him: *3 days later* Hi, so, umm, I've talked to other developers and they said it's impossible to measure in millimetres. Can you revert those changes we did?
After all this I've fully realised that this person is sits at computer very rarely and does not how it even works...5 -
Just had one of the most cringiest HR interview ever. I'm looking for a new job, and yesterday applied for several med/senior backend developer positions and immediately got response from a well known software company.
We schedule a call today 9:00am, so I take homeoffice and wake-up half an hour earlier than usual.
First thing I notice, lady is 5mins late, but okay its morning, we're all humans, so I don't mind it even though some other person might call it a classical sign of disrespect and hangup right away.
First question: Why did you apply for our company?
- Euhhmm cause I'm looking for a new job and I saw your job ad yesterday?
Second question: Why would you like to work at our company?
- Left speechless.. Well I honestly don't know, not really following your company, I know that you exist but that's about it, shouldn't you be telling me this? (*heavy breathing on the other side*)
The rest of interview left me quite uninterested due to initial questions, like what the hell, I can imagine these being alright for interns and junior developers who might be fascinated by opportunity to work for a big and well known company to build their CV, but c'mon I've went through shit already and honestly don't care for who I work for as long as they have interesting projects, are paying me right and have couple small benefits I'm looking for such as homeoffice, gym card etc..8 -
We've all had shitty jobs at one point or another, maybe some of us already had software engineering experience while having to work in a different field for a variety of reasons.
Well check this shit.
At one point(during my second year of school) for various reasons I had to work in retail. For those that know, retail can be a soul crushing experience...the trick is not letting management to convince you that it is an actual good job, it is not, and I have respect and sympathy for everyone currently working in it. The mind numbing retarded customers that we get are absolutely fantastic in every sense of the word.
My position in retail was as a phone salesman, for MetroPCS (which for all of y'all european ninjas is one of the low end phone carriers here in the U.S) and the people that we get as customers where I live are normally very poor which apparently in Mexican culture stands for annoyingly ignorant (I am Mexican myself, so I can really vouch for this shit)
One day a customer came in telling me that there was an app that he was using that kept giving him troubles, it was a map application for truck drivers. Now, obviously, this had nothing to do with my line of work(phone salesman) and as such I normally tried to explain that and let them be, but I imagined that it was a settings issue so I reluctantly agreed to help him. I explained to him that the app was no longer maintained and that the reason for it was probably that the developer abandoned it and that he would just have to look into the app, upon closer inspection the app itself was nothing more than a wrapper over google maps with trucker icons and a "trucker" interface, he was using the app as a GPS navigator and he could as well just have been using google maps.
The conversation was like this:
Me: Well this app is no longer supported, it will probably be taken off the google store soon, you can look for something similar or just change to Google maps
Retard: What? no! I came here in order for you to fix it, Metro needs to fix their own apps!
Me (in complete disbelief): We have no control over third party apps, and even for the ones that we provide the store has no control over them. But this app is not ours and so we can't really do anything about it.
Retard: Well WTF should I do? I have been having many issues with youtube and spotify, shouldn't Metro fix their Google store?
Me: Those apps are not ours.....wait, you seem to believe that we own youtube and spotify, those are not ours
Retard: How the fuck they are not yours! its your phone isn't it?
Me: Eh no.....Metro does not(at this point I was sort of smiling because I wanted to laugh) own youtube or spotify or the play store or even this phone, metro does not own Android or Samsung(his phone was a samsung core prime)
Retard: Well You need to fix this
Me: No I do not and I can not, the developer for this app abandoned it and has nothing to do with us
Retard: Well call the developer and tell him to fix it
At this point I was on a very bad mode since this dude was being obnoxiously rude from the beginning and it annoyed me how he was asking for dumb shit.
Me: Did you pay for this app?
Retard: No
Me: So you expect that some developer out there will just go about and get working for something that you did not pay for?
Why don't you just use Google maps as your GPS?
Retard: Don't be stupid, Google has no maps
At this point I show him the screen where there is a lil app that said maps, pressed it and voila! map comes to life
Retard: Well....I did not know
Me: Yeah....but I am the stupid one right?
** throws phone for him to catch
Me: Have a good one bud.
And my manager was right next to me, he was just trying to control his laughter the whole time. I really despised working in there and was glad when I left. Retail man.......such a horrible fucking world.7 -
It is time... to rant about macs!
No, seriously - I had such a different experience about which not many talk in real life or pretend that it never happens....
Model: 2015 mid MBP 15" with second to highest specs (don't have dedicated gpu).
Rattling fucking toy.... Yea, it rattles! If you shake/move ir sit in trait/bus - it non-stop rattles as a fucking toy. Worst part? It's confirmed issue by apple and it manifacturing issue that they are not keen on fixing!!!! WTF? We have 4 macs in our office - all of them fucking rattles... God help me how annoying that is. (Lose LCD control panel that unsticks from glue. Replacing it solves the issue for 1 month if you carry it anywhere).
Constant fucking crashing/updates.... Every morning I wake up and don't have an app that requires confirmation for restart - it's restarted. YAY, turning on all apps once again.... Why you may ask? Well, because if you tinker with software in any way - it fails to update it and hell breaks lose. It's been a long time since High-Sierra came around and the issue is still there (not running Mojave as it conflicts with soft I have... Woo!). Tried few times - updates fail. Resolution? Reinstall OS!
OS conflicts with applications - damn... People told me it works out of the box.... Yeah, as long as you don't upgrade the OS - then it breaks. Why? Well, because.
Piece of shit power supply. With 4 of our office power supplies - 2 of them failed twice withing warranty and once afterwards... Really? Not to mention that all 4 are starting to shear the sleeve or already did (mine is just wrapped with white electrical tape to give it a support... lol).
Bluetooth - who the hell needs that in mac, right? Well, people do. To start with - it conflicts with 2.4GHz wireless network - you might have one of those and not both at the same time. Next thing is using a device that needs constant connection (mouse, headphones, keyboard - non apple branded) - shit... They can't stay connected for more than an hour without any issues... Constant battle to re-connect it, to re-pair the device and all due to smart apple bluetooth settings. Hell, my mouse (logitech MX master) was even printing random symbols in some applications if moved. All of the issues went away after using a bluetooth dongle... WOO!!!!
Xcode... Ahh, you may never prepare your mac if you don't download 17GB of fucking xCode libraries that enables some tools to be installed/runned as you can NOT get them in any other way and you have to install full xCode software in order to get them... YAY! 17GB wasted on my 256GB SSD that I can't upgrade. GREAT!
OsX applications - ah, don't get offended but if you are using them and you are fine with them - you are probably a monkey that loves being told what to do. You can't customise any actions, you can't configure it the way you like - either you accept their default workflow or go kill yourself. Yep... Had issues with calendar, mail, iMessages, safari... None of them fit my needs :)
Resolution scaling... Fucking hell, the display is 2880 x 1800 but all you let me to use is 1440x900 without scaling? Am I blind to you? Scaling the resolution means that you are fucked if some applications don't support scaling very well. Looking at you Jetbrains - your IDES suck at scaling and slows down the pc to a potato....
Now the pros - keyboard is way better than the new ones, trackpad is GREAT - no need for mouse (using it on external 4k displays only), the battery life is great - getting around 6h of continues development time, 8 if using sublime instead of phpStorm and well, that's about it...
To clarify:
I've bought this device due to the fact that at that time mac and windows pc's with similiar specs costed the same while windows pc sucked with their quality of the device and trackpad... Now the situation is better and when time comes for a next upgrade - it's going to be one of these:
Razer Blade 15, Dell XPS 15, Lenovo Carbon X1 series.
And of course - LINUX. I've had enough issues with windows, and had enough of retardness of apple ecosystem, so switching it is a must for me.
Disclaimer: I might be an unhappy customer, a bit picky but I'd like my device to be setted up as I like and continue to have that until I don't like, not until the company decides to break it. Not to mention that paying almost a yearly salary in my country for one device - I'd expect it to be at least reliable and work without issues....
Rant over.
ps. You can disagree with me, this is my personal experience with MBP over the last 3 years :)8 -
Two big moments today:
1. Holy hell, how did I ever get on without a proper debugger? Was debugging some old code by eye (following along and keeping track mentally, of what the variables should be and what each step did). That didn't work because the code isn't intuitive. Tried the print() method, old reliable as it were. Kinda worked but didn't give me enough fine-grain control.
Bit the bullet and installed Wing IDE for python. And bam, it hit me. How did I ever live without step-through, and breakpoints before now?
2. Remember that non-sieve prime generator I wrote a while back? (well maybe some of you do). The one that generated quasi lucas carmichael (QLC) numbers? Well thats what I managed to debug. I figured out why it wasn't working. Last time I released it, I included two core methods, genprimes() and nextPrime(). The first generates a list of primes accurately, up to some n, and only needs a small handful of QLC numbers filtered out after the fact (because the set of primes generated and the set of QLC numbers overlap. Well I think they call it an embedding, as in QLC is included in the series generated by genprimes, but not the converse, but I digress).
nextPrime() was supposed to take any arbitrary n above zero, and accurately return the nearest prime number above the argument. But for some reason when it started, it would return 2,3,5,6...but genprimes() would work fine for some reason.
So genprimes loops over an index, i, and tests it for primality. It begins by entering the loop, and doing "result = gffi(i)".
This calls into something a function that runs four tests on the argument passed to it. I won't go into detail here about what those are because I don't even remember how I came up with them (I'll make a separate post when the code is fully fixed).
If the number fails any of these tests then gffi would just return the value of i that was passed to it, unaltered. Otherwise, if it did pass all of them, it would return i+1.
And once back in genPrimes() we would check if the variable 'result' was greater than the loop index. And if it was, then it was either prime (comparatively plentiful) or a QLC number (comparatively rare)--these two types and no others.
nextPrime() was only taking n, and didn't have this index to compare to, so the prior steps in genprimes were acting as a filter that nextPrime() didn't have, while internally gffi() was returning not only primes, and QLCs, but also plenty of composite numbers.
Now *why* that last step in genPrimes() was filtering out all the composites, idk.
But now that I understand whats going on I can fix it and hypothetically it should be possible to enter a positive n of any size, and without additional primality checks (such as is done with sieves, where you have to check off multiples of n), get the nearest prime numbers. Of course I'm not familiar enough with prime number generation to know if thats an achievement or worthwhile mentioning, so if anyone *is* familiar, and how something like that holds up compared to other linear generators (O(n)?), I'd be interested to hear about it.
I also am working on filtering out the intersection of the sets (QLC numbers), which I'm pretty sure I figured out how to incorporate into the prime generator itself.
I also think it may be possible to generator primes even faster, using the carmichael numbers or related set--or even derive a function that maps one set of upper-and-lower bounds around a semiprime, and map those same bounds to carmichael numbers that act as the upper and lower bound numbers on the factors of a semiprime.
Meanwhile I'm also looking into testing the prime generator on a larger set of numbers (to make sure it doesn't fail at large values of n) and so I'm looking for more computing power if anyone has it on hand, or is willing to test it at sufficiently large bit lengths (512, 1024, etc).
Lastly, the earlier work I posted (linked below), I realized could be applied with ECM to greatly reduce the smallest factor of a large number.
If ECM, being one of the best methods available, only handles 50-60 digit numbers, & your factors are 70+ digits, then being able to transform your semiprime product into another product tree thats non-semiprime, with factors that ARE in range of ECM, and which *does* contain either of the original factors, means products that *were not* formally factorable by ECM, *could* be now.
That wouldn't have been possible though withput enormous help from many others such as hitko who took the time to explain the solution was a form of modular exponentiation, Fast-Nop who contributed on other threads, Voxera who did as well, and support from Scor in particular, and many others.
Thank you all. And more to come.
Links mentioned (because DR wouldn't accept them as they were):
https://pastebin.com/MWechZj912 -
why do i have an iphone?
well, let's start with the cons of android.
- its less secure. this isn't even arguable. it took the fbi a month or something (i forget) to break into an ios device
- permission, permissions, permissions. many of the android apps i use ask for the not obscure permissions.
· no, you don't need access to my contacts
· no, you don't need access to my camera to take notes
· no, you don't need access to my microphone to send messages
· no, you don't need access to my saved passwords to be a functioning calculator
- not being able to block some apps from an internet connection
- using an operating system created and maintained by an advertising company, aka no more privacy
- i like ios's cupertino more than material design, but that's just personal preference
pros of ios:
- being able to use imessage, at my school if you don't have an iphone you're just not allowed to be in the group chat
- the reliability. i've yet a data loss issue
- the design and feel. it just feels premium
- if i could afford it, ios seems like a lot of fun to develop for (running a hackintosh vm compiled a flutter app 2x as fast as it did on not-a-vm windows)
so that's why i like iphones
google sucks55 -
Worst thing you've seen another dev do? Here is another.
Early into our eCommerce venture, we experienced the normal growing pains.
Part of the learning process was realizing in web development, you should only access data resources on an as-needed basis.
One business object on it's creation would populate db lookups, initialize business rule engines (calling the db), etc.
Initially, this design was fine, no one noticed anything until business started to grow and started to cause problems in other systems (classic scaling problems)
VP wanted a review of the code and recommendations before throwing hardware at the problem (which they already started to do).
Over a month, I started making some aggressive changes by streamlining SQL, moving initialization, and refactoring like a mad man.
Over all page loads were not really affected, but the back-end resources were almost back to pre-eCommerce levels.
The main web developer at the time was not amused and fought my changes as much as she could.
Couple months later the CEO was speaking to everyone about his experience at a trade show when another CEO was complementing him on the changes to our web site.
The site was must faster, pages loaded without any glitches, checkout actually worked the first time, etc.
CEO wanted to thank everyone involved etc..and so on.
About a week later the VP handed out 'Thank You' certificates for the entire web team (only 4 at the time, I was on another team). I was noticeably excluded (not that I cared about a stupid piece of paper, but they also got a pizza lunch...I was much more pissed about that). My boss went to find out what was going on.
MyBoss: "Well, turned out 'Sally' did make all the web site performance improvements."
Me: "Where have you been the past 3 months? 'Sally' is the one who fought all my improvements. All my improvements are still in the production code."
MyBoss: "I'm just the messenger. What would you like me to do? I can buy you a pizza if you want. The team already reviewed the code and they are the ones who gave her the credit."
Me: "That's crap. My comments are all over that code base. I put my initials, date, what I did, why, and what was improved. I put the actual performance improvement numbers in the code!"
MyBoss: "Yea? Weird. That is what 'Tom' said why 'Sally' was put in for a promotion. For her due diligence for documenting the improvements."
Me:"What!? No. Look...lets look at the code"
Open up the file...there it was...*her* initials...the date, what changed, performance improvement numbers, etc.
WTF!
I opened version control and saw that she made one change, the day *after* the CEO thanked everyone and replaced my initials with hers.
She knew the other devs would only look at the current code to see who made the improvements (not bother to look at the code-differences)
MyBoss: "Wow...that's dirty. Best to move on and forget about it. Let them have their little party. Let us grown ups keeping doing the important things."8 -
At work, my closest relation is with the DBA. Dude is a genius when it comes to proper database management as well as having a very high level of understanding concerning server administration, how he got that good at that I have no clue, he just says that he likes to fuck around with servers, Linux in particular although he also knows a lot about Windows servers.
Thing is, the dude used to work as a dev way back when VB pre VB.NET was all the rage and has been generating different small tools for his team of analysts(I used to be a part of his team) to use with only him maintaining them. He mentioned how he did not like how Microsoft just said fk u to VB6 developers, but that he was happy as long as he could use VB. He relearned how to do most of the GUI stuff he was used to do with VB6 into VB.NEt and all was good with the world. I have seen his code, proper OOP practices and architectural decisions, etc etc. Nothing to complain about his code, seems easy enough to extend, properly documented as well.
Then he got with me in order to figure out how to breach the gap between building GUI applications into web form, so that we could just host those apps in one of our servers and his users go from there, boy was he not prepared to see the amount of fuckery that we do in the web development world. Last time my dude touched web development there was still Classic ASP with JScript and VBScript(we actually had the same employer at one point in the past in which I had to deal with said technology, not bad, but definitely not something I recommend for the current state of web development) and decided that the closest thing to what he was used was either PHP(which he did not enjoy, no problem with that really, he just didn't click with the language) and WebForms using VB.NET, which he also did not like on account of them basically being on support mode since Microsoft is really pushing for people to adopt dotnet core.
After came ASP.NET with MVC, now, he did like it, but still had that lil bug in his head that told him that sticking to core was probably a better idea since he was just starting, why not start with the newest and greatest? Then in hit(both of us actually) that to this day Microsoft still not has command line templates for building web applications in .net core using VB.NET. I thought it was weird, so I decided to look into. Turns out, that without using Razor, you can actually build Web APIs with VB.NET just fine if you just convert a C# template into VB.NET, the process was...err....tricky, and not something we would want to do for other projects, with that in we decided to look into Microsoft's reasons to not have VB.NET. We discovered how Microsoft is not keeping the same language features between both languages, having crown C# as the language of choice for everything Microsoft, to this point, it seems that Microsoft was much more focused in developing features for the excellent F# way more than it ever had for VB.NET at this point and that it was not a major strategy for them to adapt most of the .net core functionality inside of VB, we found articles when the very same Microsoft team stated of how they will be slowly adding the required support for VB and that on version 5 we would definitely have proper support for VB.NET ALTHOUGH they will not be adding any new development into the language.
Past experience with Microsoft seems to point at them getting more and more ready to completely drop the language, it does not matter how many people use it, they would still kill it :P I personally would rather keep it, or open source the language's features so that people can keep adding support to it(if they can of course) because of its historical significance rather than them just completely dropping the language. I prefer using C#, and most of my .net core applications use C#, its very similar to Java on a lot of things(although very much different in others) and I am fine with it being the main language. I just think that it sucks to leave such a large developer pool in the shadows with their preferred tool of choice and force them to use something else just like that.
My boy is currently looking at how I developed a sample api with validation, user management, mediatR and a custom project structure as well as a client side application using React and typescript swappable with another one built using Angular(i wanted to test the differences to see which one I prefer, React with Typescript is beautiful, would not want to use it without it) and he is hating every minute of it on account of how complex frontend development has become :V
Just wanted to vent a little about a non bothersome situation.6 -
I dropped my kid off at preschool and went my way home.
She's 2 so I transport her on a stroller.
While coming back, I came across an old lady sweeping the sidewalk of her house, and it got narrow to pass through because there was a tree next to her.
I carefully slowed down as to not collide with her, and while going through, we noticed each other.
I did a tiny smile as a way of saying "hi" like I usually do to people on the street.
To which she gave back the most innocent and sweet smile I've ever seen a stranger give on the street.
I could honestly feel my heart crack as it happened.
I guess the stroller must have caused her sympathy thus that reaction.
(which is why I like going around with the stroller, because people tend to treat you nicely which feels nice, like butterflies)
I know it might seem like an ordinary story without a punchline, but let me explain that I walk this city everyday.
And even though the people here is very nice compared to other cities I've lived in, it is very rare to get smiled at with such joy.
You might still think that is not a good story. But I can explain its relevance.
As some of you know, I post triggering content on this account, closeted parts of me that I normally hide,
Such as sexual stuff, some people think I'm a degenerate but I like to think I just have normal sexual thoughts that don't affect others in real life AT ALL.
And I'm also very argumentative, again, some people might see it as troll behaviour. On my side though, I just don't like bullshit and call it out when I see it.
But with this post, I'm not trying to be more likable or negate all the weird shit I said. This post is just another closeted part of me, being emotional.
And the reason I hide that is because it is not generally well accepted when a man is sensitive, at least where I'm from.
For example, if a female friend at work had a nice haircut, sometimes I feel the urge to be like "omg girl you look so prettyyyy!!!!".
But if I did that I know what will happen based on DIRECT experience: people will assume I'm gay or weak, and will make fun of that.
Or the actual friend will think I'm hitting on her.
No, fucking thank you, not having that shit.
But even if people accepted that, they just can't conceive I'm also very direct and honest, so when they do get to know me better, they get shocked.
So what do I do? I just hide that. That might change in the future, but I don't have the energy right now to deal with some people's simplemindedness.
I'm not making any sort of political statement, like "people should be treat me correctly or else get fired because of offending my gender".
But I'm not gonna lie, it would feel very nice if I was around more progressive people. I wished I had just just standard male behaviour and thoughts.
I guess some people in progressive cities are more accepting of the whole gender fluid thing, so I wished I lived in one (let me clarify though, I'm not a mindless gender fanatic).
I'm also not perfect and sometimes the line between "I love your haircut" and "I'm into you" blurs the fuck out, so that's on me... I don't know if it's something I can change though...
Hopefully all this shit I'm saying doesn't make me look like a lunatic. Veeeery hopefully.
Though, If you think for real I'm a lunatic or bad person, you can suck donkey dick.14 -
I was laid off. The reason? Well, they didn't really want to say but they were clear it wasn't due to performance. (Thankfully, I got severence pay.) From my perspective it really came out of nowhere, no warnings or even hints that this was coming, which has me spinning. 😵 If I'm doing well at my job and the company is doing well, how in the seven hells could I get laid off??
What they said was partly the reason didn't seem true, or not the whole truth. They essentially stated that "they talked with everyone I worked with" (probably not true based on their decision, but who knows) and came to the conclusion I wasn't suitable to work on large teams, and that's the direction they are moving in. As if it wasn't something that could be improved on 🤔
I'll be the first to admit I'm not the best communicator face-to-face, mainly due to my social anxiety but also because I have too many thoughts. It can be difficult to condense them down for other people in the heat of the moment. (I'm an INTP, if that helps you to understand what I mean.) However, I know I'm a pretty good communicator overall since I listen and pay special attention to phrasing and word choice. So most people I worked with there seemed quite satisfied with communication with me. There were only 2-3 out of more than 12 who I had any difficulty working with.
So why did I have trouble properly working with a couple people? I hesitate to say this but, like other jobs I've had, well... they didn't have either the experience or knowledge to understand me. Basically, they were stupid. I was pretty frustrated working with such inadequately prepared people on a complex project with ludicrously short deadlines, and had no desire to work overtime so I could educate or guide them.
To give perspective, one React developer didn't understand how object properties work with JavaScript. 🤦♀️ (They are references, by the way. And yes you can have an object reference inside another object!) Another React developer thought it was okay to have side effects during the render lifestyle because they didn't affect the component itself, even if it was a state change in a parent component. 🤦♀️🤦♀️
So what is the real reason I lost my job, if not performance? Could be I pissed off the stupid (and loud) ones which hurt my reputation. My main theory, however, is that I was raising the cost of the company's healthcare. I had a diseased organ so I did miss some work or worked from home more than I should have, and used my very good health insurance to the fullest extent I could. Of course, if they say that's the reason then they can get sued.
Huge bummer, whatever the case. I definitely learned some lessons from this situation that others in a similar position could find useful. I can write that up if anyone expresses interest.
Honestly though, this is a good thing in the end, because I was already planning to leave in a month or 2 once I found a better job. I was waiting for the right time for the project I was on and for my own financial stability. So I'm trying hard not to let this affect my self-esteem and think of it as an opportunity to get my dream job, which is working with a remote-first company that is focused on improving the human condition.
Being unemployed isn't ideal, but at least I didn't have to quit! And I get to have a bit of a vacation of a sort.7 -
Why in the world IT work is so stressful?
I never been like that since I start developing code professionally, 8 years ago.
Since then, I had many health problems due stress, and some were really scaring (heart problem).
I'm trying to adapt to a healthier way of work, but I'm starting to doubt if that is possible.
Work in technology seems cruel and soulless sometimes. The constant pressure to learn new things all the time, to specialize in a lot of skills, simultaneously. The urgency nature of ALL tasks - even a simple form field slightly out of place seems to be an issue of life and death for clients.
Easy and quick communication made some people lost boundaries and respect. Many times I received calls and messages after midnight, about things like elements alignment.
And the worst is when clients blame you about their business problems. If they are not selling well this week, it's fault of the website you did ( which they are using for months now).
This actually happened to me today, first thing in the morning. After I slept just 3h, because I worked until late yesterday (oh yeah many more of these life/death updates).
What happens in this industry? Will this ever be different some day?6 -
Running a fucking conda environment on windows (an update environment from the previous one that I normally use) gets to be a fucking pain in the fucking ass for no fucking reason.
First: Generate a new conda environment, for FUCKING SHITS AND GIGGLES, DO NOT SPECIFY THE PYTHON VERSION, just to see compatibility, this was an experiment, expected to fail.
Install tensorflow on said environment: It does not fucking work, not detecting cuda, the only requirement? To have the cuda dependencies installed, modified, and inside of the system path, check done, it works on 4 other fucking environments, so why not this one.
Still doesn't work, google around and found some thread on github (the errors) that has a way to fix it, do it that way, fucking magic, shit is fixed.
Very well, tensorflow is installed and detecting cuda, no biggie. HAD TO SWITCH TO PYHTHON 3,8 BECAUSE 3.9 WAS GIVING ISSUES FOR SOME UNKNOWN FUCKING REASON
Ok no problem, done.
Install jupyter lab, for which the first in all other 4 environments it works. Guess what a fuckload of errors upon executing the import of tensorflow. They go on a loop that does not fucking end.
The error: imPoRT eRrOr thE Dll waS noT loAdeD
Ok, fucking which one? who fucking knows.
I FUCKING HATE that the main language for this fucking bullshit is python. I guess the benefits of the repl, I do, but the python repl is fucking HORSESHIT compared to the one you get on: Lisp, Ruby and fucking even NODE in which error messages are still more fucking intelligent than those of fucking bullshit ass Python.
Personally? I am betting on Julia devising a smarter environment, it is a better language already, on a second note: If you are worried about A.I taking your job, don't, it requires a team of fucktards working around common basic system administration tasks to get this bullshit running in the first place.
My dream? Julia or Scala (fuck you) for a primary language in machine learning and AI, in which entire environments, with aaaaaaaaaall of the required dlls and dependencies can be downloaded and installed upon can just fucking run. A single directory structure in which shit just fucking works (reason why I like live environments like Smalltalk, but fuck you on that too) and just run your projects from there, without setting a bunch of bullshit from environment variables, cuda dlls installation phases and what not. Something that JUST FUCKING WORKS.
I.....fucking.....HATE the level of system administration required to run fucking anything nowadays, the reason why we had to create shit like devops jobs, for the sad fuckers that have to figure out environment configurations on a box just to run software.
Fuck me man development turned to shit, this is why go mod, node npm, php composer strict folder structure pipelines were created. Bitch all you want about npm, but if I can create a node_modules setting with all of the required dlls to run a project, even if this bitch weights 2.5GB for a project structure you bet your fucking ass that I would.
"YOU JUST DON'T KNOW WHAT YOU ARE DOING" YES I FUCKING DO and I will get this bullshit fixed, I will get it running just like I did the other 4 environments that I fucking use, for different versions of cuda and python and the dependency circle jerk BULLSHIT that I have to manage. But this "follow the guide and it will work, except when it does not and you are looking into obscure github errors" bullshit just takes away from valuable project time when you have a small dedicated group of developers and no sys admin or devops mastermind to resort to.
I have successfully deployed:
Java
Golang
Clojure
Python
Node
PHP
VB/C# .NET
C++
Rails
Django
Projects, and every single fucking time (save for .net, that shit just fucking works on a dedicated windows IIS server) the shit will not work with x..nT reasons. It fucking obliterates me how fucking annoying this bullshit is. And the reason why the ENTIRE FUCKING FIELD of computer science and software engineering is so fucking flawed.
But we can't all just run to simple windows bs in which we have documentation for everything. We have to spend countless hours on fucking Linux figuring shit out (fuck you also, I have been using Linux since I was 18, I am 30 now) for which graphical drivers for machine learning, cuda and whatTheFuckNot require all sorts of sys admin gymnasts to be used.
Y'all fucked up a long time ago. Smalltalk provided an all in one, easily rollable back to previous images, easily administered interfaces for this fileFuckery bullshit, and even though the JVM and the .NET environments did their best to hold shit down, and even though we had npm packages pulling the universe inside, or gomod compiling shit into one place NOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO we had to do whatever the fuck we wanted to feel l337 and wanted.
Fuck all of you, fuck this field, fuck setting boxes for ML/AI and fuck every single OS in existence2 -
Who am I?
Some of you, because of the hyperbolic, outrageous, trollish, and often self-satirical nature of my posts, might doubt me. Thats completely relatable.
Heres the truth:
I was diagnosed in childhood with ADHD, fucking everyone, every male, these days is diagnosed with that. I was diagnosed bipolar. Hell anyone reading my posts could see that from a mile away. I was diagnosed on the borderline personality spectrum. Yeah, I could see that.
I was tested. They said I was in the 98th percentile for clerical ability, not extraordinary but pretty good, mathematical ability a little higher than that. My SAT was 1491. Not yale material, but I coulda been someone.
Over the years I studied a LOT of politics and read a metric fuckton of books. (40+ books over the course of three years).
I predicted every single presidential election since bush juniors second election. Three supreme court picks. Senatorial elections. Congresional elections. More than that.
I have a better analysis track record than some of the multidecade analysts sitting in the fucking NSA.
No I am not shitting you. No I am not exaggerating.
It's about the only claim to fame I get to legitimately make.
People ask me, "then why aren't you famous?"
How do you know I'm not.
Look I'm gonna tell you my actual name.
My real name is Lawrence B. Lindsey
Okay, I'm bullshitting for fun. But words I have written on alt twitter accounts have legitimately come out of presidential hopeful's mouths. No, this I am *not* bullshitting you about.
Imagine that. A guy who lived in his parents attic for five years, writing words that came out of presidential candidates mouths.
At one time I was about as popular and influential as that fuckboy catturd.
yes, really. No I am not fucking joking.
Under normal conditions I wouldn't talk about this or reveal it, because who the fuck cares? I'm just some dude on the internet, drunk, both on alcohol, and the pseudo-anonymous equivalent of bragging rights.
You know how many women I turned down because I could? You know how fucking drunk I am? They say a drunk man's words are a sober man's thoughts. Well, I'm not usually honest like this because the internet is full of false braggarts, and you tell people the truth and they don't fucking believe you.
I swear, it seems like I made some faustian bargain at some time, and can achieve no fame or lasting wealth in my life--to save my life.
Shit, I was talking to a chinese women who ran a bank in china (yes, really), who advised me to buy into bitcoin early on. Didn't have the money to. Woulda been a fucking millionaire if I did.
*Non-obvious* Ideas that major corporations are now persuing? Yeah those were sitting in my card index since the early 2000s.
I helped two people build and sell businesses. One for me tens of thousands. Another for millions. Yes, really. Got zero, and I mean, *zero* credit for it.
Point is, doesn't matter how famous you are, or coulda been, Doesn't matter the ideas you have, or had.
The world doesn't promote runners-up, or hasbeens, or wannabes, or could-bes.
What matters is execution.
If you're wandering through life, wondering when you're lucky break will be, stop. You have to realize, you make your own luck. Recognize the difference between what you can control, and what you can, and work on promoting your own ideas or business or values, instead of other people's dreams.
And for those wondering, yes I am drunk, and no, I ain't fucking kidding you in anything I wrote here.
The most important lesson I learned is this:
First work on your own success, before you work on the success of others.
p.s.
I give surprisingly good advice for someone who doesn't benchmark well on traditional measures of success. I know, even I was shocked when I looked at the statistics.30 -
Simple there are four other developers on my team. Yet, I do all of the work.
I'm picky about spesific tasks, so I would rather do THOSE by myself, by we have a Trello board where I've marked the tasks I want to do myself, and everything else is open for grabs.
Some tasks I will asign others (one developer specifically) and days will pass and no code gets touched. So I end up having to take it over. :|
Like, guys, I get it. You have other things to do. But could you atleast *try* and help me without me having to ask? If not, then why did you even sign up? I want to get this out the door so our project doesn't go under and we can make some money. I have other things I would like to do as well, you know. Like take a day off, or spend time with my girlfriend.9 -
Let's share information! Communicate! How do we do it? Via email!
You got question? Send an emai!
You want to share some excel? Send an email!
Not sure who to ask? Send the email to everyone!
Have a 100 message long email thread and then need some help? Send the whole fucking thread to me and just add "what do'ya think?"!
Send some attachment in email and then 2 weeks later refer to it saying "but I sent the file to you!"? Well surely I can remember your special email from the hundreds of email I get every week.
I did complain to the mangers that why the hell do we have these mega-email-threads? Why do you send all the meaningles release notes to the whole company? The anwer is simple: all information needes to be transparent and if you don't need the info, then just don't read the email!
And fuck you, you CEO wanna-be who sends seasonal greetings through his secretary and thinks anyone gives a shit.4 -
Not really a programming story... but a story about how programmers problem solve in real life.
Mods, sort me out if I'm out of line. Anyway, here goes.
So, my wife and I are arguing about whether or not the garage has insulated walls.
"It doesn't have insulated walls", I say, "I've been up in the rafters and their's no insulation there, so there's probably none in the walls."
"Well, why can't you just check", my better half responds, "You could just punch a hole in the wall to see."
Me, taking about 300ms to process this statement. Looks over, and punches a hole in the wall.
"See, no insulation!!!" I say triumphantly.
"What. The. Fuck. Did you just punch a hole in the wall for???"
deerinheadlights.gif
"Um, because you told me to?"
"Well I didn't mean to use your hand, I meant to get a small drill so the hole wouldn't be enormous."
"Well you didn't say "get a small drill", you said "punch"!
And as a laid down to sleep, on the couch, that night I still insist she told me to do it. And while I patched that hole, I still thought it was her fault. And to this day I still think it's her fault.
You cannot give a programmer these vague instructions and expect appropriate results.5 -
I was just writing a long rant about how my rant style changed, and how I could fix anything that annoys me in a heartbeat by just putting my mind to implementing a change. Then YouTube once again paused the synth mix that was playing on my laptop in the background, with that stupid "Video paused. Continue watching?" pop-up. I even installed an add-on for it in Firefox to make it automatically click that away. I guess that YouTube did yet another bullshit update to break that, for "totally legitimate user interface improvements" or whatever. Youtube-dl faces similar challenges all the time, and it's definitely not alone in that either. I also had issues with that on Facebook when I wanted to develop on top of that, where the UI changes every other day and the API even changes every other week. And as far as backwards compatibility goes, our way or the highway!
So I did the whole "replace and move on" type of thing. I use youtube-dl often now to get my content off YouTube into a media player that doesn't fuck me over for stupid reasons like "ad fraud" (I use an ad blocker you twats, what ads am I gonna fraud against), or "battery savings" (the damn laptop is plugged in and fully topped up for fucks sake, and you do this crap even on desktop computers). Gee I wonder why creators are moving on to Floatplane and Nebula nowadays, and why people like yours truly use "highly illegal" youtube-dl. Oh and thank you for putting me in Saudi Arabia again. Pinnacle of data mining, machine learning and other such wank could not do GeoIP. for a server that used to be in a datacenter in Italy for years, and recently has been moved to another hosting provider in Germany. It's about as unchanging and static, and as easy to geolocate as you can possibly get. But hey, kill off another Google+ when?
Like seriously, yes I'm taking your Foobar challenges and you may very well be the company I end up working for. But if anything it feels like there's a shitton of stuff to fix. And the challenges themselves still using Python 2.7 honestly feels like the seldom seen tip of the iceberg.1 -
!dev
I need to rant about something that has been on my mind lately.
Someone, actually. Friend/romantic interest of mine, from a few years back.
NGL, I liked him. A lot more than I should have. The man had his own issues, but I refused to tolerate his poisonous behavior. Truth be told, didn't want to hate him, even though he was trying his best to get me there. And so, one day I ended up blocking him after a fight. A few months back, I tried to reconnect. Same behavior. But this time around he did say that he was done with me. So instead of sitting through the torture of his "reasons why you suck" presentation, I blocked him again.
Now, I hope he's doing well. Never wanted anything but happiness for him. And as much as I miss him, I think it's better for him to stay away from me too. I mean, if I trigger him that badly, maybe I shouldn't be around him anyways.
Nowadays, I'm staying away from someone else again. Similar scenario. Reason being that I was actually being mistreated, and again I refuse to be tortured to the point of hating the object of my affection.
I wonder if I get attracted to the torture. I'm okay with dying alone tbh, what I'm not okay with is falling for those who don't want my love and much rather kill it.
... Actually, at this point in life I don't even want to fall for anyone anymore. (That is not the same thing as dating someone I like tho. That, I would do) The darker side of me says those who I fall for are all the same type of disappointment, but the brighter side says that I am enough, complete as is, and not everyone needs someone else. idk maybe I'm being a tad narcissistic, or hyper-independant, or flakey and afraid of attachment. But that first friend occasionally pops up in my thoughts, and reminds me that not everyone appreciates when you don't let someone make you hate them.
Oh well. *sigh*6 -
Project manager, who i've complained in the past is neglecting critical things that he doesn't want to do, decided today to cancel our weekly planning meeting, to have the below conversation with me 1:1. Its very long, but anyone who has the will to get through it ... please tell me it's not just me. I'm so bewildered and angry.
Side note: His solution to the planning meeting not taking place ... to just not have one and asked everyone to figure it out themselves offline, with no guidance on priorities.
Conversation:
PM: I need to talk to you about some of phrasing you use during collaboration. It's coming across slightly offensive, or angry or something like that.
Me: ok, can you give me an example?
PM: The ticket I opened yesterday, where you closed it with a comment something along the lines of "as discussed several times before, this is an issue with library X, can't be fixed until Y ...".
"As discussed several times" comes across aggressive.
Me: Ok, fair enough, I get quite frustrated when we are under a crunch, working long hours, and I have to keep debugging or responding to the same tickets over and over. I mean, like we do need to solve this problem, I don't think its fair that we just keep ignoring this.
PM: See this is the problem, you never told me.
Me: ... told you what?
PM: That this is a known issue and not to test it.
Me: ..... i'm sorry ..... I did, that was the comment, this is the 4th ticket i've closed about it.
PM: Right but when you sent me this app, you never said "don't test this".
Me: But I told you that, the last 3 times that it won't be in until feature X, which you know is next month.
PM: No, you need to tell me on each internal release what not to test.
Me: But we release multiple times per week internally. Do you really need me to write a big list of "still broken, still broken, still broken, still broken"?
PM: Yes, how else will I know?
Me: This is documented, the last QA contractor we had work for us, wrote a lot of this down. Its in other tickets that are still open, or notes on test cases etc. You were tagged in all of these too. Can you not read those? and not test them unless I say I've fixed them?
PM: No, i'm only filling for QA until we hire a full time. Thats QA's job to read those and maintain those documents.
Me: So you want me to document for you every single release, whats already documented in a different place?
PM: ok we'll come back to this. Speaking of hiring QA. You left a comment on the excel spreadsheet questioning my decision, publicly, thats not ok.
Me: When I asked why my top pick was rejected?
PM: Yes. Its great that you are involved in this, but I have to work closely with this person and I said no, is that not enough?
Me: Well you asked me to participate, reviewing resumes's and interviewing people. And I also have to work extremely close with this person.
PM: Are you doubting my ability to interview or filter people?
Me: ..... well a little bit yeah. You asked me to interview your top pick after you interviewed her and thought she was great. She was very under qualified. And the second resume you picked was missing 50% of the requirements we asked for ... given those two didn't go well, I do think its fair to ask why my top pick was rejected? ... even just to know the reason?
PM: Could you not have asked publicly? face to face?
Me: you tagged me on a google sheet, asking me to review a resume, and rather than tag you back on 2 rows below ... you want me to wait 4 days to ask you at our next face to face? (which you just cancelled for this meeting)
PM: That would have been more appropriate
Me: ..... i'm sorry, i don't want to be rude but thats ridiculous and very nit pick-y. You asked my opinion on one row, I asked yours on another. To say theres anything wrong with that is ridiculous
PM: Well we are going to call another team meeting and discuss all this face to face then, because this isn't working. We need to jump to this other call now, lets leave it here.5 -
You do know that "why do I need you if I can copy-paste code from SO?" joke floating around, right? Today I had a real-life situation perfectly illustrating it.
So I bought a set of parking sensors. Cheap ones, from AliExpress. Prolly the cheapest ones I could find. Installed them w/ engine turned off. All seemed fine. Cleaned it all up, got ready to go, started the engine and beeeep beeep beeepeeeeep beepp ..... beeeeeeeeep.
fuck.
Tried unplugging/replugging them one-by-one to find the faulty one. Nada. Apparently they all were false-alarming. They must all be bad, bcz they seem to work well w/ engine turned off (ignition on) and only false-alarm when engine is on.
Allright, I'll get a new set next weekend, a more expensive one and replace them again.
There goes my €20 and another week basically w/o parking sensors (car length is >5 meters, so sensors do help a lot).
Today I spend a few hours removing my rear bumper again, replacint all the sensors, wiring, etc. Tests show promising results - all sensors seem OK even w/ engine on! Close it all up, start a car again and.... beeep bep bep beeep beeee..eeeeppp.
MOTHER FUCK!
Another 30min-hour goes by while looking for a possible culprit. And I found it. The fix could did not take longer than 5 seconds. Apparently a wire feedint the sensors' controller was too close to sensors' wires. All I had to do is to push that wire a lil further from the controller with my index finger.
I could have saved €30, a week of time, half a day of work if I only knew what wire to [literally] poke.
shit...4 -
Good question, what wasn't bad about 2020?
As far as good things go.. well, COVID-19 actually. Back in February the lockdown began in Belgium, and while many people got bored out of their minds, I actually became a lot more productive. So many projects started back then, and I got a lot better at programming because of it. Now I can confidently write most bash stuff without ever looking anything up. And the code is maintainable, on account of putting everything into functions. You can literally navigate the code just by looking at it. On older code I always had issues with that.
I'm very glad that essential travel even back then wasn't really restricted. Because my bank is retarded about online banking, I have to go to the bank every so often to check my balance. At the time I tended to do that late in the evening, when nobody else was outside and I had the entire town to myself. That was one of the travels considered essential. So I kept doing it and made that my biweekly walk. I really enjoyed that. Gets your mind off things.
Bad things would be the utter stupidity that the general public had shown me during that pandemic. Burning down 5G antennas and not even getting the right ones, toilet paper, 5G death beams in street lamps?! They even sent death threats to telco workers over sensationalist bullshit from what IIRC was just a random Twitch streamer. Those people should just fucking kill themselves, choke yourselves in that pile of toilet paper you got yourself and then called yourself financially challenged. You braindead fucking retards!
Another dev-related thing is the normalization of SJW terminology. Now even "blind playthrough" gets your ass banned on Twitch. I saw a tweet about a Twitch employee (I think) proudly saying that they implemented it. Most upvoted comment on it was from a blind person, asking why they did this and not made the Twitch app more friendly to use for blind users. They too thought this was bullshit. Yet it still got added in, and more and more people are starting to think that "this is fine". Hell even that "this is necessary".
What annoys me the most is that this mostly comes from the US, where around that time they laid their knee on George Floyd, and didn't fix their legal system at all. As a European it baffles me since we have many immigrants here (the Drumpf even called Belgium a hellhole over it) and we just don't give a shit about whether or not they are "truly Belgian". We just let them live their daily lives like everyone else. Imagine just not giving a shit. Imagine not bothering them, not with racism, not with reverse racism, not with anything. Just let them do their thing and that's it. Yet despite Belgium being one of the most inclusive countries in the fucking world, I still got called a racist many times for asking.. why did you implement this? Why this, and not tackling the problem at its actual and pretty fucking obvious core?
So all in all I can only hope that 2021 will get a little bit better. But that's the same thing I said in 2019, and it didn't quite come true.7 -
TL;DR:
JuniorDev ignores every advice, writes bad code and complains about other people not working because he does not see their result because he looks at the wrong places.
Okay, so I am really fed up right now.
We have this Junior Dev, who is now with us for circa 8 months, so ca. a year less than me. Our first job for both of us.
He is mostly doing stuff nobody in the team cares about because he is doing his own projects.
But now there's a project where we need to work with him. He got a small part and did implement that. Then parts of the main project got changed and he included stuff which was not there anymore. It was like this for weeks until someone needed to tell him to fix it.
His code is a huge mess (confirmed by senior dev and all the other people working at the project).
Another colleague and me mostly did (mostly) pair programming the past 1-2 weeks because we were fixing and improving (adding functionality) libraries which we are going to use in the project. Furthermore we discussed the overall structure and each of us built some proof-of-concept applications to check if some techniques would work like we planned it.
So in short: We did a lot of preparation to have the project cleaner and faster done in the next few weeks/months and to have our code base updated for the future. Plus there were a few things about technical problems which we need to solve which was already done in that time.
Side note: All of this was done not in the repository of the main project but of side projects, test projects and libraries.
Now it seems that this idiot complained at another coworker (in our team but another project) that we were sitting there for 2 weeks, just talking and that we made no progress in the project as we did not really commit much to the repository.
Side note: My colleague and me are talking in another language when working together and nobody else joins, as we have the same mother tongue, but we switch to the team language as soon as somebody joins, so that other colleague did not even know what we were talking about the whole day.
So, we are nearly the same level experience wise (the other colleague I work with has just one year more professional experience than me) and his work is confirmed to be a mess, ugly and totally bad structured, also not documented. Whereas our code is, at least most of it, there is always space for improvement, clean, readable and re-useable (confirmed by senior and other team members as well).
And this idiot who could implement his (far smaller part) so fast because he does not care about structure or any style convention, pattern or anything complains about us not doing our work.
I just hope, that after this project, I don't have to work with him again soon.
He is also one of those people who think that they know everything because he studied computer science (as everybody in the team, by the way). So he listens to nothing anybody explains to him, not even the senior. You have to explain everything multiple times (which is fine in general) and at some points he just says that he understood, although you can clearly see that he didn't really understand but just wants to go on coding his stuff.
So you explain him stuff and also explain why something does not work or is not a good thing, he just says "yes, okay", changes something completely different and moves on like he used to.
How do you cope with something like this?6 -
So i just had an interesting conversation.
View source images in comments
So some background. I used to do a lot of Minecraft development and server configuration. And Minecraft being made of mostly 12-year-olds they really don't pay very well. So I moved on from Minecraft but someone reached out for me to do their configuration for their server. (this was about a month ago) and I quoted them 40/hr because that's what I charge for my web dev work. So he promptly declined and I thought that was that. But tonight he messaged me and found a 5 month old post saying how I was looking to do free development work in order to get experience. And here is how the converstion when.
(His name is "Candy")
Candy:
Lol
Trying to take advantage of me with your bullshit $40/hour claims
Which is outright laughable
https://mc-market.org/threads/...
”I am looking for a network to stay long-term with and help/see it grow into a bigger server. (I would expect pay later down the road if we work together on an ongoing basis)”
—
Quoting your MC-Market post.
What do you have to say for yourself? Trying to take advantage of people?
Going to say something else completely delusional or own up to the fact that you were trying to take advantage of me?
I already knew you were, but now I have the hard evidence.
As I am not a stupid person.
Not only did your friend lie, but you tried to take advantage of me, thinking I was stupid enough to fall for your $40/hour bullshit for basic configuration work. MineSaga charges $30.00 an hour on the high. Don’t even try to do the same shit you did to me to anyone else. It won’t work.
Me:I was interested in doing plugin development and learning so I offered my services for free so I could learn in a more real environment. I no longer do minecraft plugins rather I am a web developer and my rate is $40/hr I am good at configuration which is why i contacted you but I am not going to lower my rate because it is "simpler" work. Just like how you can higher a prostitute to wash your car but it would be cheaper to get the kid from around the block to do it. Also not sure what your end goal is here. I gave you my rate and you didn't agree with it. So you should just move on. Plus this is the minecraft world let me know when you get to the real world so you you can pay in big boy money.
Candy:
So your configuration work for minecraft is $40/h as well?
Lol
Absolutely hilarious.
Me:
did you not read my message?
"I am not going to lower my rate because it is "simpler" work."
Candy:
Who were your most recent clients?
Me:
i'm not going to give you that information
Candy:
Because you know you are lying to me with your crazy rates, and if you aren't, that means you have near to no clients.
Yet another lie.
Me:
keep telling yourself that buddy
Candy:
Lol
Good luck getting any more clients.
rip
Me:
?
I get more clients all the time
They just are not in your realm of your minecraft imagination where you can pay a developer 20$/hr
Candy:
I just strongly disagree with the fact that you are charging $40/hour for configurative work
xD
Me:
Okay
But why even contact me? Did you really think trying to "Call me out" was going to have me lower my rates or something.
Just get over it
Candy:
I haven't called you out and overcharging like that to others in the minecraft realm for a significant gain in money for work that is not worth nearly that amount is absolutely delusional.
I would recommend you stop making up false assumptions
Me: What ever you say
I left it at that. There was some more stuff but it was not that interesting so i left it out5 -
I used to work with a teacher in my last uni year.
The job consisted on doing a kinda-like management system for a business. It all began kinda "right", we agreed upon a price for 6 months of my work (a very lowball price, but it was just right because I was learning stuff that we were going to be using).
Fast-forward first six months, all I do is code frontend, mockup screens and whatsoever because this "business" hadn't give us proper requirements (Yeah, I told him to ask for them, but nothing came through).
So I was like well, I'll keep working in this project because I really want to finish it. Sidenote: I was doing all the "hard work", he didn't know how to code, and he calls himself a teacher... wtf).
Months go by, and a year goes round, in between these months, he spoke to me, that he wanted me that we kept working together, that we could renegotiate the payment (I asked him to give me my payment once the job was done). I agreed, but my uni residence period was coming along and I got an oportunity to go abroad to another country.
So there I was, in the need of money to buy my passport, plane tickets and other stuff, so I asked him for the payment.
Needs to be noted, that the last 6 months work was me doing tutorials on how to fucking use Linux, how to use PostgreSQL, how to fucking use CSS! He told me he would pay me extra for it.
The day came, and I received my payment... the exact amount we talked a year ago, I was like "Seriously dude?", but well, I needed the money and I didn't have time to argue, so we talked a little bit about me helping him and I told him "As long as I have time, I'll help, but remember that I'm going abroad to work for a small startup, so maybe I'll be up to my head with work" he agreed, we nod and then I left.
First week abroad came in and I was doing a shit-ton of stuff, then his first message comes around "Hey, I need more tutorials! ASAP! Before 6PM"
What.The.Fuck. I told you, son of a bitch, that I wouldn't be able to do them until weekend.. and it was monday!
So I ignored it, weeks went throught and my "angry mood" was fading away so I said to myself "Well, it's time to pick up that stuff again", I open Slack and I find a week old message with a document attached, it was a "letter", I just skimmed by it and read some keywords "deceptioned... failed me.."
Sure dude? Was I the failure? Becase, as far as I remember, you were the fucktard that didn't know how to fucking install a VM!
A week went by, and then randomly a friend of mine talks to me through Facebook:
E: Hey, how are you?
M: I'm fine, what's up?
E: What did you do to TEACHER?
M: Nothing, <explains all situation>
E: Well, It seems weird, that's why I wanted to talk with you, I believe in you, because I know you well, but TEACHER it's thrashing shit about you with all his students on all of his classes
M: Seriously?
E: Yeah, he's saying that you are a failure, irresponsible, that you scammed him
That moment, I for sure, lost all moral responsibility with him and thought to myself "He can go fuck himself with my master branch on his ass"
So when I got back to my country, I had to go around in school, avoiding him, not because I was ashamed nor anything by the way, just because I knew that If i ever had the disgrace to meet him face to face, my fists would be deep into his nose before he could say "Hey".
Moral of the story:
If you overheard that a teacher has a bad rep, not by one, nor two, but more than +100 people, maybe it's true.
Good thing my friends and others know me well and I didn't have repercutions on my social status, I'm just the guy that "fucked up TEACHER because I had the right and way to do it"4 -
Let me tell you why I feel like a shit right now. I work as sw dev in a country worse than Germany and company I interviewed is located in Germany. So this is kinda big deal for me.
I interviewed with the company last year, interview went really well. They told me during interview that they would return in 2 weeks tops. It took 2 months for them tor return. For some reason, I was not hired for that position. Later I learned that the division i was gonna work defunded/separated. After learning that the guy I interviewed really tried hard to give me good news but failed-therefore had to delay bad news, I was not sad for not being able to be accepted for that position or delayed response.
Fast forward to this year, I interviewed with the same company for a position as subcontractor employee on another company. Interview took just before Coronavirus situation started to blow up(mid March), I had to return to my home country when the borders were closed asap, 2 day after interview. Fast forward to May I got the job offer and contract with a good salary, July as starting date. But I have no Visa and you apply for visa with a valid contract. German embassies work at minimum capacity, no new applications for any type of visa including work/residence visa. After my serious research I found a crack, emailed the embassy and they finally agreed to give me a special appointment on the start of July. The company I interviewed sent me new contract(August starting date) automatically.
On mid July, I told the company that visa might not come soon enough, I might not make it to August to start to job. We both agreed to replan starting date once i got the Visa.
On August 6, my visa came. I informed them asap, and they told me the other company will return in 3 weeks with new starting date. I was like WTF we were waiting for this visa for months, why do you need 3 weeks. Anyways, 3 weeks past and the other company still did not give any new starting date. I really feel like shit right now. Last week I asked to the "my" company if there is a problem with my employment(the other company might change plans after all) and they said only starting date is the problem, don't worry. On 3 occasions, they reassured me there was no problem(no, I was not asking them like paranoiac obsessive person, they were preemptively saying it in some cases). They say other company employees were really asking about when I was coming frequently.
What should one do in such situation. Do I even have legal rights? Maybe I will look back at this post and laugh at my paranoia, but I would you random internet citizens' ideas on this situation. They say lightning does not strike twice to same point but living same disappointment with the same company would really hurt. rant over, mamba out.8 -
Pull-to-refresh is useless.
If you are a mobile app developer, please get rid of pull-to-refresh. Your users will thank you.
I have the impression that mobile app developers choose to implement the pull-to-refresh gimmick just in order to make their app comply with a design trend. It seems like a desperate attempt to appear "modern" and "fancy", not because of the actual usefulness of the gesture.
Pull-to-refresh is one of those things that are well-intended but backfire. It appears helpful on first sight, but turns out to be a burden.
It takes effort and cognitive strain to avoid triggering a pull-to-refresh. The user can't use the app relaxed but has to walk on eggshells.
Every unwanted refresh wastes battery power, mobile data (if it is an Internet-connected app), and can lead to the loss of form data.
To avoid pull-to-refresh, the user has to resort to finger gymnastics like a shorter swipe for scrolling up or swiping slightly up before down. Pull-to-refresh could even be triggered while pinch-zooming in or out near the top of a page, if the touchscreen does not recognize one of the two fingers.
Pull-to-refresh also interferes with the double-tap-swipe zoom gesture. If one of the two taps are not recognized, a swipe-down to zoom in can trigger a pull-to-refresh instead.
To argue "if you don't like pull-to-refresh, just don't use it" is like blaming a person who stepped on a mine, since the person moved and the mine was stationary.
A refresh button can be half a second away in the menu bar, URL bar, or a submenu, where it is unlikely to be pressed accidentally. There is no need for a gesture that does more harm than good.
Using a mobile app with pull-to-refresh feels like having Windows StickyKeys forcibly enabled at all times. The refresh circle animation sticks to the finger.
If the user actually wants to refresh, pull-to-refresh is slower than a refresh button in a menu if the page is not at the top, meaning pull-to-refresh is useless as a shortcut anyway if the page is in any other position than the top.
An alternative to pull-to-refresh is pull-for-details. Samsung did it in some of their apps. Pulling down against the top reveals additional information such as the count and total size of selected items.
If you own a website, add this CSS to make browsing your website on the pre-installed Android web browser not a headache:
html,body { overscroll-behavior: none; }
Why is this necessary? In 2019, Google took the ability to deactivate the pull-to-refresh gesture on their Chrome browser for Android OS away from users. On Chrome for Android, pull-to-refresh can only be disabled on the server side, not the user side. The avalanche of complaints? Neglected.
Good thing several third-party browsers let the user turn off this severe headache.12 -
Sorry, long since my last post...
I have quit my job recently at DERP & CO.. The level of anxiety was already somewhat of medical severity.
For months I had been in a project that not only did not progress, but that it was getting worst day by day.
A bit of Context
November: "Dev, junior anon needs you to help him on the SHIT project because they are running out of time, it is mainly doing unit tests."
Well, the code was a mess, there was a LOT of copy paste and it was all bad quality (we talk about methods with complexities between 80 and 120 according to SONAR QUBE).
Dev: "Anon, you know this is wrong, right?"
Anon: "Why? it works"
Dev: after long explanation.
Anon: "Oh well, yes, from now on I will take it into account." And he did it / try his best.
Dev does the unit tests and do extra work outside of the reach of the sprint (y than i mean work after hours, classic) and alerts the boss of the mess.
December: After a project of approximately 6 or 8 months of development, the boss discovers that the junior anon have been doing everything wrong and/or with poor quality (indicating that throughout the whole development the quality of the code was NEVER checked nor the functionality).
Boss: "This is a shit. Dev, you have to correct all the errors and warnings marked on sonar", which are around 1200 between smelling code, high risk errors, etc.
Dev fixes something like 900 bugs... lots of hours...
Boss: "This still is all wrong, we have to redo it. We will correct the errors leaving something stable and we will make a new repository with everything programmed as it should be, with quality and all"
- 900 corrections later, now are irrelevant -
Boss: "Dev, you will start to redo it, anon is out on other project. First you must leave the existing one working properly"
Dev: "ok ..."
January: How can I correct the mess if the client asks for more things. I am just fixing the mess, doing new functionalities, and when I have free time (outside the work) I try to advance the new repository, poorly I must say because burntout.
Boss: "Everything should be arranged at the end of January, so that you can redo everything well in February."
I can't handle everything, it starts to fall further behind. Junior Anon quits the job.
February: Big Bad Bugs in the code appear and practically monopolize the month (the code is very coupled with itself and touching in one place sometimes meant breaking other stuff).
Boss: "It can't be, you've been with this since January and you haven't even started correcting this mess in the new repo"
Dev: "It is that between the new things that are requested and the bugs I cannot put myself with that"
Boss: "Do not worry, you will be helped by random dev if you needed. SPOILER ALERT: random dev is allways bussy. Not made up bussy, He had a lot of work by itself, but it can't help me the way I need it.
High anxiety levels, using free time to try to reduce the work left and gradually losing the taste for develop.
March: So far, not only do they add new things day and day, but now they want to modify things that were already "ok", add new ones and refactor everything in a new repo. I just did not see an end of this nonsense.
Dev breaks, the doctor says it's anxiety, so I just know what I have to do.
Dev: "I quit my job"
Cool Manager: "Damn, why?"
Explain everithig
Cool Manager: "Do you want to try if I can change you to other project or anotjer scope on the same project?"
Dev: "Thanks, but no Thanks. I need to stop for a while".
End. sry for long sad post and maybe poor use of English (?) Not my native language.10 -
*get task assigned to me*
*complete task*
*get new task changing everything I did in the previous task*
Me: "Why is this getting completely changed? It meets the specs you sent."
PM: "Well, they took a while to approve the concept so I assumed it would be the same as the one on their current site. But now they want something different. Just change it."
ARE YOU FUCKING KIDDING ME. WHAT IN THE ACTUAL FUCK IS THE POINT OF SENDING FOR APPROVAL IF YOU ARE NOT GOING TO WAIT FOR THE APPROVAL?!2 -
I once interviewed for a role at Bank of America. The interview process started off well enough, the main guy asked some general questions about career history and future goals. Then it was off to the technical interviewers. The first guy was fine. Asked appropriate questions which he clearly understood the answers to.
The next guy up, however, was what I like to call an aggressive moron. After looking at my resume, he said I see you listed C++. To which I said, yes I have about 7 years of experience in it but I've mostly been using python for the past few years so I might be a bit rusty. Great he said, can you write me a function that returns an array?
After I finished he looked at my code, grinned and said that won't work. Your variable is out of scope.
(For non C programmers, returning a local variable that's not passable by value doesn't work because the local var is destroyed once the function exits. Thus I did what you're supposed to do, allocate the memory manually and then returned a pointer to it)
After a quick double take and verifying that my code did work, I asked, um can you explain why that doesn't work as I'm pretty sure it does.
The guy then attempted to explain the concept of variable scope to me. After he finished I said, yes which is why I allocated the memory manually using the new operator, which persists after the function exits.
Einstein then stared really hard at my code for maybe 10 to 15 seconds. Then finally looked up said ok fine, but now you have a memory leak so your code is still wrong.
Considering a memory leak is by definition an application level bug, I just said fine, any more questions?4 -
Absolutely not dev-related.
Blah, blah, weird conversation and shit. I'm too tired and lazy to write this crap again, but let's do it.
The guy is a dev I randomly found on some chatting service, he was interesting to talk with until this conversation. I'll write this out of memory, so yeah.
Him: So by the way I wrote an app that you give your penis size to to get measurements and stuff about it.
Me, thinking it was dev humor: That's hilarious. Tell me more, I'm interested.
Him: So the idea behind all of this was to gather some big data style info about people's penis size and habits and all that stuff.
Me: Man that's awesome. Can I see the source?
Him: No, it's proprietary. You can buy a license though.
Me: You went that far for a joke?
Him: What joke?
Me: The whole software you just told me about.
Him: That's not a joke, I'm being very serious about it.
Me: Oh well. What did you get from the stats?
Him: I got some tips from people's habits! I never thought that shaving it could make it look bigger, but that's awesome!
Me: Do you really care about it that much?
Him: Studies have proven that size correlated with confidence. Since I started doing it, I've been more confident than ever!
Me: Great.
Him: I'm a bit disappointed to see that I'm in the lower percentiles though.
Me: Well of course you are.
Him: Why would you say that?
Me: Well since people with a big dick tend to go more willingly into the subject and might even buy a fucking app for it, of course you'd have the higher average in your stats.
Him: You're only saying that because you have a small cock.
Me: Why the fuck would you say that? You're the one that's concerned about it, not me.
Him: Go on, what's your size?
Me, because I don't care about discussing that stuff: *Tells him*
Him: [stats, comparisons and stuff]
Me: Well I never gave a fuck and your stats won't make me change my mind.
[ ... Some other shit about my size compared to his ... ]
Him: Would you want to work with me for the database maintenance?
Me: You must be joking?
Him: I'm serious.
Me: *Deletes account*
Seriously, fuck that guy. I rewrote that quickly so you only had the best, but it was a whole fucking conversation.3 -
! rant
Sorry but I'm really, really angry about this.
I'm an undergrad student in the United States at a small state college. My CS department is kinda small but most of the professors are very passionate about not only CS but education and being caring mentors. All except for one.
Dr. John (fake name, of course) did not study in the US. Most professors in my department didn't. But this man is a complete and utter a****le. His first semester teaching was my first semester at the school. I knew more about basic programming than he did. There were more than one occasion where I went "prof, I was taught that x was actually x because x. Is that wrong?" knowing that what I was posing was actually the right answer. Googled to verify first. He said that my old teachings were all wrong and that everything he said was the correct information. I called BS on that, waited until after class to be polite, and showed him that I was actually correct. Denied it.
His accent was also really problematic. I'm not one of those people who feel that a good teacher needs a native accent by any standard (literally only 1 prof in the whole department doesn't), but his English was *awful*. He couldn't lecture for his life and me, a straight A student in high school, was almost bored to sleep on more than one occasion. Several others actually did fall asleep. This... wasn't a good first impression.
It got worse. Much, much worse.
I got away with not having John for another semester before the bees were buzzing again. Operating systems was the second most poorly taught class I've ever been in. Dr John hadn't gotten any better. He'd gotten worse. In my first semester he was still receptive when you asked for help, was polite about explaining things, and was generally a decent guy. This didn't last. In operating systems, his replies to people asking for help became slightly more hostile. He wouldn't answer questions with much useful information and started saying "it's in chapter x of the textbook, go take a look". I mean, sure, I can read the textbook again and many of us did, but the textbook became a default answer to everything. Sometimes it wasn't worth asking. His homework assignments because more and more confusing, irrelavent to the course material, or just downright strange. We weren't allowed to use muxes. Only semaphores? It just didn't make much sense since we didn't need multiple threads in a critical zone at any time. Lastly for that class, the lectures were absolutely useless. I understood the material more if I didn't pay attention at all and taught myself what I needed to know. Usually the class was nothing more than doing other coursework, and I wasn't alone on this. It was the general consensus. I was so happy to be done with prof John.
Until AI was listed as taught by "staff", I rolled the dice, and it came up snake eyes.
AI was the worst course I've ever been in. Our first project was converting old python 2 code to 3 and replicating the solution the professor wanted. I, no matter how much debugging I did, could never get his answer. Thankfully, he had been lazy and just grabbed some code off stack overflow from an old commit, the output and test data from the repo, and said it was an assignment. Me, being the sneaky piece of garbage I am, knew that py2to3 was a thing, and used that for most of the conversion. Then the edits we needed to make came into play for the assignment, but it wasn't all that bad. Just some CSP and backtracking. Until I couldn't replicate the answer at all. I tried over and over and *over*, trying to figure out what I was doing wrong and could find Nothing. Eventually I smartened up, found the source on github, and copy pasted the solution. And... it matched mine? Now I was seriously confused, so I ran the test data on the official solution code from github. Well what do you know? My solution is right.
So now what? Well I went on a scavenger hunt to determine why. Turns out it was a shift in the way streaming happens for some data structures in py2 vs py3, and he never tested the code. He refused to accept my answer, so I made a lovely document proving I was right using the repo. Got a 100. lol.
Lectures were just plain useless. He asked us to solve multivar calculus problems that no one had seen and of course no one did it. He wasted 2 months on MDP. I'd continue but I'm running out of characters.
And now for the kicker. He becomes an a**hole, telling my friends doing research that they are terrible programmers, will never get anywhere doing this, etc. People were *crying* and the guy kept hammering the nail deeper for code that was honestly very good because "his was better". He treats women like delicate objects and its disgusting. YOU MADE MY FRIEND CRY, GAVE HER A BOX OF TISSUES, AND THEN JUST CONTINUED.
Want to know why we have issues with women in CS? People like this a****le. Don't be prof John. Encourage, inspire, and don't suck. I hope he's fired for discrimination.11 -
Stupid ass nimble fucker of an old friend talks to me for a whole week after a reunion saying stuff like "I'm glad we got to spent time together bro and stuff", the soul eater of poop being sets up a conversation over a week talking like he was a true friend. He only had to manage it for a week more, hell he had to resist his urge for a puny ass week and I would've considered that maybe good people existed. Well the universe along with this Pseudo-panty fuck decided it was time, they pitch me an "idea". Well after demonstrating kindly that I could technically pull (n) such ideas from my virtual butthole. The guy finally believes his idea was stupid and moves away. A minute later. SURPRISE MOTHER FUCKER! he says, telling me that he got an amazing idea along and if I could help him with some stuff. Well.. What? I jumped at this amazing opportunity. Not because of the dangling-dickina of an idea, because this was my way out of this misery fucks life. Alright should buy me some time right? He would go watch some tutorials, make a logo and call me when there's a problem. We'll in the milli fucking time that even a big bang couldn't have recurred, the bitch calls and says.. Bro, sorry for disturbing you, I need some help... [What did your mother from another son tell you she only gave birth to half of you?]
APPARENTLY, THE GUY JOINED FORCES WITH SOME INTELLIGENT MINDS AND SETUP A LEAGUE OF LIKE MINDED NECROPHILES AND I COULD HELP THIS DREAM TEAM with a name and a logo.
It started, I could sense it. I wasn't THE CHOSEN ONE. Tired, I said I'll see what I can do while attempting to block his number. A few hours later, he calls from another number with no shame and asks BRO? DID YOU. Did me what you bloody dick lubricator. Yeah I watched your mom a couple times, then I got bored when I found out it was an ad.
Unfortunately no I did not tell that, instead I used the kindest words I could pull out of my frustrated ass to tell him I won't do it cause I have better things to do.
The guy comes back a few hours later with an emotional back-story of how this is his way out of his sad ass life and saying stuff like sorry to disturb you bro, I never meant to.
Oh my gawd! Give this douche manufacturer an Oscar. Actually give him two!!
————
After this traumatic experience I often feel for such people. They have around 90 years to live. They have a free fucking brain. They have money. They have less problems.
Why can't they come up with a worthy idea with all these factors to compound the ideation process.
And why on the earth can't they make the Idea on their own. I'm completely self taught so I don't see it being a problem. I could well say that I'm more knowledgeable than a few grads out of my stupid college but I don't wanna compare myself to those stupid beings.
If you have an idea? Make it. Die for it. But never approach another being, either he eats you or you eat him.4 -
Why am I sad, depressed, demotivated, you ask?
Because I was asked to create-react-app with nodemailer, it worked well on heroku, YAYYY MEE, "
"NOTHING GOES WRONG IN DEPLOYMENT FUCK YEAH"
Little did I know that was a "demo" for the business people, My superior / manager/boss wants me to deploy on 1and1 service provider,
> Okay 1 and 1 service provider does provide Nodej, so it shouldn't be hard.
> Turns out it is a Windows hosting server IIS 10 without URL Rewrite.
> *INTERNAL SCREAMING*
I went up to him to talk about this issue and requested to let me talk to 1 and 1, and get this sorted
> But bro, if we cannot fix it, I think they also cannot fix, probably.
*INTERNAL SCREAMING AT PEAK*
I just want URL Rewrite installed on IIS10 so that I can move on to the next project.
A little background for this project
> No support from him during development.
> I personally used HD Images, because why not?
> Website seems slow because of HD Images, and now he complains about it.
You fucking (managers) want a website to be scalable and fast and yet you choose to focus on B U S I N E S S instead of support the real guy.
I'm fucking sick and tired, it took me 24 hours figure out the issue because there is nothing on 1 and 1 support/ forum/help center.
Another 24 hours to try and fix, yet no luck.
I'm gonna finally point the domain name to heroku. Fuck, I'm so fucking done6 -
I take the train well out side of rush hour when the trains are about half empty (though most seats taken). I have to come in because it's not like I can afford to have a workspace comparable to the cockpit of the millennium falcon both at home and at work.
I don't believe going into a panic about coronavirus but take obvious basic precautions to at least reduce the chance and slow the spread and that should do a good amount to reduce overloading the system. I kid you not, at this point medical facilities are considering buying diving equipment for enriched O2 supplies to keep up.
Today, as usual, some fucking piece of shit cunt twat psycho beggar that literally needs to be in an asylum with a massive fucking great gob of snot dangling out his nose is going up the entire train, every carriage, begging groping every hand rail along the way and potentially exposing several hundred people every hour.
I told this sorry sack of shit, surprisingly politely, that he'll end up rapidly spreading coronavirus if he keeps going all the way up and down the carriage like that. After he's fucking muttering on trying to make people feel bad about fucking ignoring him not being all caring and shit and then doesn't give a shit about giving everyone coronavirus after fucking waltzing down the entire fucking length of the train his pockets stuffed with coin. Then he threatens to assault me. I was fucking this > < far away from unleashing a life changing beat down and kicking his ass off the train with no pain or injury spared.
At the same time, that piece of scum waste of skin the mayor has apparently informed the public that you can't get coronavirus on the train or buses. How the fuck did he come to that conclusion? Is this really happening? How can something that clinically fucking thick as shit be our lord and master?
I fucking thought the great toilet paper rush was brain dead. Jesus fucking Christ and people voted for this fucking championship moron. Why don't they just all save themselves the fucking hassle and all march themselves off a fucking cliff?
These dumb shits without two neurons to rub together only need to put a dozen or so plain clothed police offices on the trains to catch these fuckers.
Why am I even fucking paying taxes? Where's it all fucking going? Another fucking lets give a billion quid to Fujitsu fucking failed IT project again I bet. Can't people bloody do anything these days? Does there have to be an app for fucking everything?
Someone should make a fucking facial recognition app so I can snap a shot of these fuckers and then if one of these fucking passes the phone camera anyone else with the app it'll set of there's a fucking imbecile in the vicinity alert.
These people need to be dragged out into the street, lined up against the wall and shot. No remorse. Toss them in a pit, cover it with dirt and be done with it. Why even bother with the execution? Throw them down the hole and fill it with dirt.
You don't have to go mental like it's the plague but people could at least show some fucking common sense, common decency and basic decorum. Even minimal measures, is that much to ask? Absolute scum of the Earth. How we even allow them to walk to Earth I do not fucking know.1 -
Github 101 (many of these things pertain to other places, but Github is what I'll focus on)
- Even the best still get their shit closed - PRs, issues, whatever. It's a part of the process; learn from it and move on.
- Not every maintainer is nice. Not every maintainer wants X feature. Not every maintainer will give you the time of day. You will never change this, so don't take it personally.
- Asking questions is okay. The trackers aren't just for bug reports/feature requests/PRs. Some maintainers will point you toward StackOverflow but that's usually code for "I don't have time to help you", not "you did something wrong".
- If you open an issue (or ask a question) and it receives a response and then it's closed, don't be upset - that's just how that works. An open issue means something actionable can still happen. If your question has been answered or issue has been resolved, the issue being closed helps maintainers keep things un-cluttered. It's not a middle finger to the face.
- Further, on especially noisy or popular repositories, locking the issue might happen when it's closed. Again, while it might feel like it, it's not a middle finger. It just prevents certain types of wrongdoing from the less... courteous or common-sense-having users.
- Never assume anything about who you're talking to, ever. Even recently, I made this mistake when correcting someone about calling what I thought was "powerpc" just "power". I told them "hey, it's called powerpc by the way" and they (kindly) let me know it's "power" and why, and also that they're on the Power team. Needless to say, they had the authority in that situation. Some people aren't as nice, but the best way to avoid heated discussion is....
- ... don't assume malice. Often I've come across what I perceived to be a rude or pushy comment. Sometimes, it feels as though the person is demanding something. As a native English speaker, I naturally tried to read between the lines as English speakers love to tuck away hidden meanings and emotions into finely crafted sentences. However, in many cases, it turns out that the other person didn't speak English well enough at all and that the easiest and most accurate way for them to convey something was bluntly and directly in English (since, of course, that's the easiest way). Cultures differ, priorities differ, patience tolerances differ. We're all people after all - so don't assume someone is being mean or is trying to start a fight. Insinuating such might actually make things worse.
- Please, PLEASE, search issues first before you open a new one. Explaining why one of my packages will not be re-written as an ESM module is almost muscle memory at this point.
- If you put in the effort, so will I (as a maintainer). Oftentimes, when you're opening an issue on a repository, the owner hasn't looked at the code in a while. If you give them a lot of hints as to how to solve a problem or answer your question, you're going to make them super, duper happy. Provide stack traces, reproduction cases, links to the source code - even open a PR if you can. I can respond to issues and approve PRs from anywhere, but can't always investigate an issue on a computer as readily. This is especially true when filing bugs - if you don't help me solve it, it simply won't be solved.
- [warning: controversial] Emojis dillute your content. It's not often I see it, but sometimes I see someone use emojis every few words to "accent" the word before it. It's annoying, counterproductive, and makes you look like an idiot. It also makes me want to help you way less.
- Github's code search is awful. If you're really looking for something, clone (--depth=1) the repository into /tmp or something and [rip]grep it yourself. Believe me, it will save you time looking for things that clearly exist but don't show up in the search results (or is buried behind an ocean of test files).
- Thanking a maintainer goes a very long way in making connections, especially when you're interacting somewhat heavily with a repository. It almost never happens and having talked with several very famous OSSers about this in the past it really makes our week when it happens. If you ever feel as though you're being noisy or anxious about interacting with a repository, remember that ending your comment with a quick "btw thanks for a cool repo, it's really helpful" always sets things off on a Good Note.
- If you open an issue or a PR, don't close it if it doesn't receive attention. It's really annoying, causes ambiguity in licensing, and doesn't solve anything. It also makes you look overdramatic. OSS is by and large supported by peoples' free time. Life gets in the way a LOT, especially right now, so it's not unusual for an issue (or even a PR) to go untouched for a few weeks, months, or (in some cases) a year or so. If it's urgent, fork :)
I'll leave it at that. I hear about a lot of people too anxious to contribute or interact on Github, but it really isn't so bad!4 -
Rant time of 'Derp & Co.'
Today I decided that I am going to find another job, I just can't keep with this shit.
They said that use Agile: FALSE.
• Daily (best scenario) take like 1 hour and a half.
• New task enter the sprint and "Fuck you, more task in the same time". This is something regular done.
• "Oh, dev, we need you to check this other project" I am in the middle of my sprint on this project. "But you have to fix this bug here". (3 fucking days the bloody bug) "You are late again with tasks".
• Meeting for fresh sprint: 6 BLOODY hours... nonstop
The workflow is garbage:
• SOMEONE should did all the devops shit on the first sprint, guess what? They did nothing!, guess now who is being blamed for it (not only me, but a few coworkers).
• Nothing is well designed/defined:
~ task are explained like shit
~ times measured wrongly
~ We are in the last fucking SPRINT and still doing de ER of the DataBase cause Oh, apparently no one has work before with SQL (damn you MongoDB! (Not really)) so I am doing my best, but "jezz dev, this is so hard... maybe we can do it WRONG and easy".
~ No one is capable of take responsability of their mess, they just try to push down the problems. (Remember the devops situatuion? Why is.my fault? I came at the 3 or 4 sprint and I am doing backend tasks, I know nothing about devops).
But the big prize, the last one:
• Apparently you can't send whatever you want to the boss, it has to pass a filter previously of coordinators and managers, hell yeah!
And I am an idiot too!
because I see that we can't reach our schedule and do hours on my spare time!
This is because there are a few good coworkers who probably ended with my unfinished tasks... and they are equaly fucked as me...
This is just the tip of the iceberg. I am not a pro, I am not a full stack developer and still need to learn a lot, but this is just not normal, eight months like this...3 -
Inspired by @NoMad. My philosophy is that technology is a means to and ends. We’re a tool oriented species. As it relates to software and hardware, they should be your means to achieve your ends without you needing to think. Think of riding a bicycle or driving a car. You aren’t particularly conscious of them - you just adjust input based on heuristics and reflex - while your doing the activity.
For a long time Software has been horrendously bad at this. There is almost always some setup involved; you need to front-load a plan to get to your ends. Funny enough we’re in the good days now. In the early days of GUI you did have to switch modes to achieve different things until input peripherals got better.
I’ve been using windows from 95 and to this day, though it’s gotten better it’s not trivial to setup an all in one printer and scan a document - just yesterday I had to walk my mother through it and she’s somewhat proficient. Also when things break it’s usually nightmare to fix, which is why fresh installing it periodically is s meme to this day. MS still goes to great lengths with their UI so that most people can still get most of their daily stuff done without a manual.
I started Linux in University when I was offered an intro course on the shell. I’ve been using it professionally ever since. While it’s good at making you feel powerful, it requires intricate knowledge to achieve most things. Things almost never go smoothly no matter how much practice you have, especially if you need to compile tools from source. It also has very little in the ways of safe guards to prevent you from hurting yourself. Sure you might be able to fix it if you press harder but it’s less stress to just fresh install. There is also nothing, NOTHING more frustrating than following documentation to the T and it just doesn’t work! It is my day job to help companies with exactly this. Can’t really give an honest impression of the GUI ux as the distros have varying schools of thoughts with their desktop environments. Even The popular one Ubuntu did weird things for a while. In my humble opinion, *nix is better at powering the internet than being a home computer your grandma can use.
Now after being in the thick of things, priorities change and you really just want to get things done. In 2015 I made the choice to go Mac. It has been one of my more interesting experiences. Honestly, I wish more distros would adopt its philosophy. Elementary only adopted the dock. It’s just so intuitive. How do you install an application? You tap the installer, a box will pop up then you drag the icon to the application folder (in the same box) boom you are done. No setup wizards. How to uninstall? Drag icon from app folder to trash can. Boom done. How to open your app? Tap launch pad and you see all your apps alphabetically just click the one you want. You can keep your frequent ones on the dock. Settings is just another app in launchpad and everything is well labeled. You can even use your printers scanner without digging through menus. You might have issues with finder if your used to windows though and the approach to maximizing and minimizing windows will also get you for a while.
When my Galaxy 4 died I gave iPhone a chance with the SE. I can tell you that for most use cases, there is no discernible difference between iOS and modern android outside of a few fringe features. What struck me though was the power of an ecosystem. My Mac and iPhone just work well together. If they are on the same network they just sync in the background - you need to opt in. My internet went down, my iMac saw that my iPhone had 4g and gave me the option to connect. One click your up. Similar process with s droid would be multi step. You have airdrop which just allows you to send files to another Apple device near you with a tap without you even caring what mechanism it’s using. After google bricked my onHub router I opted to get Apples airport series. They are mostly interchangeable and your Mac and iOS device have a native way to configure it without you needing to mess with connecting to it yourself and blah. Setup WiFi on one device, all your other Apple devices have it. Lots of other cool stuff happen as you add more Apple devices. My wife now as a MacBook, an IPad s d the IPhone 8. She’s been windows android her life but the transition has been sublime. With family sharing any software purchase works for all of us, and not just apples stuff like iCloud and music, everything.
Hate Apple all you want but they get the core tenet that technology should just work without you thinking. That’s why they are the most valued company in the world12 -
Hello, my name is Adam, I'm from Poland.
As a 16 year old dude I thought it would be a great idea to go to an IT focused highschool so I'd get my degree after finishing school but guess what- I completely fucked up.
First, there were the little things, like the teachers favoring other students that already knew stuff, which was okay and all- the problem began when Poziomka appreared (one of our PC service teachers). That motherfucker almost fluked me because of dumb shit like the PC's we worked on took forever to boot, so he's just go and give people F's, "Why?" you may ask- well because "It was obviously the student that made the PC run so slowely".
There were a few more incidents like when we were disassembling and assembling those dumb HP Compaq's PC's on time- and that fucker gave me an F because it took about 10 minutes to boot by itself.
That shit got me so demotivated its unreal, soon I found myself in a pretty dark spot, with my parents divorcing, my whore mother taking all the money- me not finding any reason to do anything in school and the cycle looped.
I'm not gonna pull the depression card here, but what I'm generally trying to say is that although I'm not "awful" at IT in general, so PC assembly, networking, programming (fuck that, I'm fucking awful at it), HTML, I still find it difficult to do anything right.
I have a question, how do I get myself back up? Any ideas?
There's so much material I've gone through in the last three years- and I just wanna make sure to get good- somehow.
I'm just a talentless dumbass kid who just wants to know how to do linux, programming and such, but I don't know where or how to start anymore.
If anyone has any stories where they turned their life around and managed to do IT right- please, tell me how you did it, I just wanna know is there a proper way of doing it.
- Adam13 -
Hiring a third party to help us with something...
Third party: yeah okay, we know what we need. Can we get access to your git repo
Me: sure, I'll make sure you'll get it
(To the admins): hey can you get them access to our git server?
Admins: did they sign the personal data processing contract?
Me: oh they won't work with any personal data. It's a dev server and they only need access to the source code. And the usual contracts and NDAs are already done
Admins: well we still need the other one.
... Sure. Why not. Just delays the start of the process for... Like a week and a half until that useless bit of paper has passed through all the necessary departments. Not like time's an issue. Right?8 -
Sometimes I don't know if my co-worker is that stupid or...
Well, he came to me with an strange problem with mongoose.
I looked at the error message. And guess what the database was not reachable. Asked him, did you check the mongo db service. No. Of course the service was not running. Told him to restart it. Then he restarted robo t not the service itself. Major face palm. He then asked me if I knew why his service was not running. Do I look like some kind of wizard? Told him to check the logs. Long story short, his drive ran out of space....2 -
what kind of dumb fuck you have to be to get the react js dev job in company that has agile processes if you hate the JS all the way along with refusing to invest your time to learn about shit you are supposed to do and let's add total lack of understanding how things work, specifically giving zero fucks about agile and mocking it on every occasion and asking stupid questions that are answered in first 5 minutes of reading any blog post about intro to agile processes? Is it to annoy the shit out of others?
On top of that trying to reinvent the wheels for every friggin task with some totally unrelated tech or stack that is not used in the company you work for?
and solution is always half-assed and I always find flaw in it by just looking at it as there are tons of battle-tested solutions or patterns that are better by 100 miles regarding ease of use, security and optimization.
classic php/mysql backend issues - "ooh, the java has garbage collector" - i don't give a fuck about java at this company, give me friggin php solution - 'ooh, that issue in python/haskel/C#/LUA/basically any other prog language is resolved totally different and it looks better!' - well it seems that he knows everything besides php!
Yeah we will change all the fucking tech we use in this huge ass app because your inability to learn to focus on the friggin problem in the friggin language you got the job for.
Guy works with react, asked about thoughts on react - 'i hope it cease to exists along with whole JS ecosystem as soon as possible, because JS is weird'. Great, why did you fucking applied for the job in the first place if it pushes all of your wrong buttons!
Fucking rockstar/ninja developers! (and I don't mean on actual 'rockstar' language devs).
Also constantly talks about game development and we are developing web-related suite of apps, so why the fuck did you even applied? why?
I just hate that attitude of mocking everything and everyone along with the 'god complex' without really contributing with any constructive feedback combined with half-assed doing something that someone before him already mastered and on top of that pretending that is on the same level, but mainly acting as at least 2 levels above, alas in reality just produces bolognese that everybody has to clean up later.
When someone gives constructive feedback with lenghty argument why and how that solution is wrong on so many levels, pulls the 'well, i'm still learning that' card.
If I as code monkey can learn something in 2 friggin days including good practices and most of crazy intricacies about that new thing, you as a programmer god should be able to learn it in 2 fucking hours!
Fucking arrogant pricks!8 -
!dev
I will never understand the need for weeding bs. I am ok with marriage, and doing whatever religious festivity you want to whatever deity you follow. I respect that stuff enough to not go all anti-religious or what not. But I just cannot fathom making a party that benefits the attendee (food whatnot) more than the people starting a life together. Gifts? a popularity contest? I don't get it. My weeding was simple, did not invite a bunch of people, shit burned bridges, but our families were there and that to me was more than enough. Anyone else that got offended, well, they can get offended whenever they pay one of my fucking bills.
But I just cannot get the need to have such a ceremony, AND then to have the audacity to get upset or call out people that cannot make it. Make it for fucking what? the bridge and groom are going to be so fucking distracted with everyone that at most your presence gets an "ah glad you came!"
AND some people even do it in different cities, fucking why? it is a burden as an adult to make time for such minute events, even more to take the time, and the fucking money to go to your fucking party on another city. Bonus points if I need to buy a fucking airplane ticket, no fucking thanks.
I am currently doing something big in my life that only my wife can help me with, because of my situation, my family can't help me, so i am all by myself and wife, and some people told me to put it on hold.....to go to a fucking party. WHY? Why in the sweet holy Mexican baby Ritchie would I go ahead and fucking do that? you are not going to help me afterwards when I get back, shit, you will be out on fucking vacation after the party, for 2 fucking weeks (talk about privilege) and you still want me to put my shit on hold to go...to a fucking party?
Fuck, sometimes I feel that I am toooo fucking egotistical to put my time before others, but man, you really get shit out of this. 2 weedings happening this month, one requires a ticket, the other is a drive away (4 fucking hours) but still, I really don't feel that I should waste my VL that I would much rather spend with my wife and child on some fucking obnoxious ego-inflated party.9 -
Get ready for a awesome conspiracy theory/ WhatsApp forward :D i like how people are coming with new stuff every minute of their boredom . Makes you ponder:
====================================
🔥🔥🔥🔥🔥🔥
How to dominate the world quickly?
THE GREAT CHINESE STAGE
1. Create a virus and the antidote.
2. Spread the virus.
3. A demonstration of efficiency, building hospitals in a few days. After all, you were already prepared, with the projects, ordering the equipment, hiring the labor, the water and sewage network, the prefabricated building materials and stocked in an impressive volume.
4. Cause chaos in the world, starting with Europe.
5. Quickly plaster the economy of dozens of countries.
6. Stop production lines in factories in other countries.
7. Cause stock markets to fall and buy companies at a bargain price.
8. Quickly control the epidemic in your country. After all, you were already prepared.
9. Lower the price of commodities, including the price of oil you buy on a large scale.
10. Get back to producing quickly while the world is at a standstill. Buy what you negotiated cheaply in the crisis and sell more expensive what is lacking in countries that have paralyzed their industries.
After all, you read more Confucius than Karl Marx.
PS: Before laughing, read the book by Chinese colonels Qiao Liang and Wang Xiangsui, from 1999, “Unrestricted Warfare: China’s master plan to destroy America”, on Amazon, then we talk. It's all there.
🔥🔥🔥🔥🔥🔥🔥🔥
Worth pondering..
Just Think about this...
How come Russia & North Korea are totally free of Covid- 19? Because they are staunch ally of China. Not a single case reported from this 2 countries. On the other hand South Korea / United Kingdom / Italy / Spain and Asia are severely hit. How come Wuhan is suddenly free from the deadly virus?
China will say that their drastic initial measures they took was very stern and Wuhan was locked down to contain the spread to other areas. I am sure they are using the Anti dode of the virus.
Why Beijing was not hit? Why only Wuhan? Kind of interesting to ponder upon.. right? Well ..Wuhan is open for business now. America and all the above mentioned countries are devastated financially. Soon American economy will collapse as planned by China. China knows it CANNOT defeat America militarily as USA is at present
THE MOST POWERFUL country in the world. So use the virus...to cripple the economy and paralyse the nation and its Defense capabilities. I'm sure Nancy Pelosi got a part in this. . to topple Trump. Lately President Trump was always telling of how GREAT American economy was improving in all fronts. The only way to destroy his vision of making AMERICA GREAT AGAIN is to create an economic havoc. Nancy Pelosi was unable to bring down Trump thru impeachment. ....so work along with China to destroy Trump by releasing a virus. Wuhan,s epidemic was a showcase. At the peak of the virus epidemic. ..
China's President Xi Jinping...just wore a simple RM1 facemask to visit those effected areas. As President he should be covered from head to toe.....but it was not the case. He was already injected to resist any harm from the virus....that means a cure was already in place before the virus was released.
Some may ask....Bill Gates already predicted the outbreak in 2015...so the chinese agenda cannot be true. The answer is. ..YES...Bill Gates did predict. .but that prediction is based on a genuine virus outbreak. Now China is also telling that the virus was predicted well in advance. ....so that its agenda would play along well to match that prediction. China,s vision is to control the World economy by buying up stocks now from countries facing the brink of severe ECONOMIC COLLAPSE. Later China will announce that their Medical Researchers have found a cure to destroy the virus. Now China have other countries stocks in their arsenal and these countries will soon be slave to their master...CHINA.
Just Think about it ...
The Doctor Who declared this virus was also Silenced by the Chinese Authorities...13 -
I used to think that I had matured. That I should stop letting my emotions get the better of me. Turns out there's only so much one can bottle up before it snaps.
Allow me to introduce you folks to this wonderful piece of software: PaddleOCR (https://github.com/PaddlePaddle/...). At this time I'll gladly take any free OCR library that isn't Tesseract. I saw the thing, thought: "Heh. 3 lines quick start. Cool.", and the accuracy is decent. I thought it was a treasure trove that I could shill to other people. That was before I found out how shit of a package it is.
First test, I found out that logging is enabled by default. Sure, logging is good. But I was already rocking my own logger, and I wanted it to shut the fuck up about its log because it was noise to the stuffs I actually wanted to log. Could not intercept its logging events, and somehow just importing it set the global logging level from INFO to DEBUG. Maybe it's Python's quirk, who knows. Check the source code, ah, the constructors gaves `show_log` arg to control logging. The fuck? Why? Why not let the user opt into your logs? Why is the logging on by default?
But sure, it's just logging. Surely, no big deal. SURELY, it's got decent documentation that is easily searchable. Oh, oh sweet summer child, there ain't. Docs are just some loosely bundled together Markdowns chucked into /doc. Hey, docs at least. Surely, surely there's something somewhere about all the args to the OCRer constructor somewhere. NOPE! Turns out, all the args, you gotta reference its `--help` switch on the command line. And like all "good" software from academia, unless you're part of academia, it's obtuse as fuck. Fine, fuck it, back to /doc, and it took me 10 minutes of rummaging to find the correct Markdown file that describes the params. And good-fucking-luck to you trying to translate all them command line args into Python constructor params.
"But PTH, you're overreacting!". No, fuck you, I'm not. Guess whose code broke today because of a 4th number version bump. Yes, you are reading correctly: My code broke, because of a 4th number version bump, from 2.6.0.1, to 2.6.0.2, introducing a breaking change. Why? Because apparently, upstream decided to nest the OCR result in another layer. Fuck knows why. They did change the doc. Guess what they didn't do. PROVIDING, A DAMN, RELEASE NOTE. Checked their repo, checked their tags, nothing marking any releases from the 3rd number. All releases goes straight to PyPI, quietly, silently, like a moron. And bless you if you tell me "Well you should have reviewed the docs". If you do that for your project, for all of your dependencies, my condolences.
Could I just fix it? Yes. Without ranting? Yes. But for fuck sake if you're writing software for a wide audience you're kinda expected to be even more sane in your software's structure and release conventions. Not this. And note: The people writing this, aren't random people without coding expertise. But man they feel like they are.5 -
Fresh internship story (Part 3)
Turns out my coworker with a mental disorder(adhs and idk what you call it. He is 24 years old, but is mentally between 16 and 18) is gay.
ATTENTION: DO NOT READ ANY FURTHER SINCE THIS IS GOING TO GET DISGUSTING!
My cheap coworker's name is Justin btw. I felt a weird atmosphere when I joined the team. Justin seemed to be a hetero guy. (I am generally assuming that every guy and girl I met is hetero). But he had his slightly "gay moves".
Yesterday, I was curious about it and asked him about why he was afraid about the police to identify him on a video to start the conversation. He told me that his ex did cheat on him. Since I assumed that he was hetero I asked if the girl was cheating on him. He got embarrassed.
him:"I uhmm... am... not hetero. I am...*stops talking*"
me:"What? Are you bi? Are you gay? What are you?"
him:"I am gay."
me:"Oh... *tries to hide the shock* I see.*silence for a minute*"
me:"What is the name of your ex?"
Justin:"Fabian. Fabian had a video and pictures of me and he put them online and did spread them with everyone. After that I got punched by some dudes. Now I want to take my revenge."
me:"... well... now that makes sense.*silence*"
I felt sorry for him and decided to keep listening. I made a wrong decision there.
2 hours later he told me how he got gay, because I wanted to know if he was born gay or if he became gay.
He told me his whole life was full of sex.
He found a sextape of his parents and jerked off to it without cuming since he did not even hit puberty yet. Then he had sex with a 6 year old girl and then with a 12 year old girl when he was 8 or something in both cases.
Later he got into a place full of guys.
He first started jerking off to hetero porn among the dudes. I wonder how he got no shame while doing it. Anyways, after that he began to feel something for boys and less for girls since boys were able to understand him more than girls. Then he became gay and his sex life with boys started.
It was very disgusting, but I wanted to know it.
next morning:
*he keeps talking about how Fabian fucked him outside in the bushes and I keep ignoring him*7 -
BielyApp, yeah, GOOOOOOOOD IDEA! I still can‘t understand how this works or why did a reasonable human being though that this would be a great idea! 🤔
Ok. There‘s a community that lives 4 or 5 hours from my my city. I don‘t want to offend anybody, so let‘s call them “Bielys” (just a random name, I don’t know if there’s actually a group or etnia with that name).
Bielys live isolated from modernity, they speak their own language and they don’t use technology.
A dev friend of mine was having a hard time (he got divorced and was almost in bankrupt). One day, a man asked him and another dev to work on a mobile app:
...
“BielyApp”.
...
It was supposed to be a movile app for commerce. Bielys could sell and buy biely stuff from another bielys. Well, at this point you can figure out why this was a bad idea. Anyway, they developed it. Even it’s on GooglePlay and AppStore 😱 I installed it to see if it was truth or not. Incredibly it was true. BielyApp exists and the worst thing is that you can log in with your facebook account. WTF?!
I asked to him “But why?! WHY?! They don’t even use smartphones!!!!”
And he answered “I know, but I needed the money”1 -
In today's episode of kidding on SystemD, we have a surprise guest star appearance - Apache Foundation HTTPD server, or as we in the Debian ecosystem call it, the Apache webserver!
So, imagine a situation like this - Its friday afternoon, you have just migrated a bunch of web domains under a new, up to date, system. Everything works just fine, until... You try to generate SSL certificates from Lets Encrypt.
Such a mundane task, done more than a thousand times already... Yet... No matter what you do, nothing works. Apache just returns a HTTP status code 403 - Forbidden.
Of course, what many folk would think of first when it came to a 403 error is - Ooooh, a permission issue somewhere in the directory structure!
So you check it... And re-check it to make sure... And even switch over to the user the webserver runs under, yet... You can access the challenge just fine, what the hell!
So you go deeper... And enable the most verbose level of logging apache is capable of - Trace8. That tells you... Not a whole lot more... Apparently, the webserver was unable to find file specified? But... Its right there, you can see it!
So you go another step deeper and start tracing the process' system calls to see exactly where it calls stat/lstat on the file, and you see that it... Calls lstat and... It... Returns -1? What the hell#2!
So, you compile a custom binary that calls lstat on the first argument given and prints out everything it returns... And... It works fine!
Until now, I chose to omit one important detail that might have given away the issue to the more knowledgeable right away. Our webservers have the URL /.well-known/acme-challenge/, used for ACME challenges, aliased somewhere else on the filesystem - To /tmp/challenges.
See the issue already?
Some *bleep* over at the Debian Package Maintainer group decided that Apache could save very sensitive data into /tmp, so, it would be for the best if they changed something that worked for decades, and enabled a SystemD service unit option "PrivateTmp" for the webserver, by default.
What it does is that, anytime a process started with this option enabled writes to /tmp/*, the call gets hijacked or something, and actually makes the write to a private /tmp/something/tmp/ directory, where something... Appeared as a completely random name, with the "apache2.service" glued at the end.
That was also the only reason why I managed fix this issue - On the umpteenth time of checking the directory structure, I noticed a "systemd-private-foobarbas-apache2.service-cookie42" directory there... That contained nothing but a "tmp" directory with 777 as its permission, owned by the process' user and group.
Overriding that unit file option finally fixed the issue completely.
I have just one question - Why? Why change something that worked for decades? I understand that, in case you save something into /tmp, it may be read by 3rd parties or programs, but I am of the opinion that, if you did that, its only and only your fault if you wrote sensitive data into the temporary directory.
And as far as I am aware, by default, Apache does not actually write anything even remotely sensitive into /tmp, so...
Why. WHY!
I wasted 4 hours of my life debugging this! Only to find out its just another SystemD-enabled "feature" now!
And as much as I love kidding on SystemD, this time, I see it more as a fault of the package maintainers, because... I found no default apache2/httpd service file in the apache repo mirror... So...8 -
Many years ago, when I moved from a semi-experienced developer to an absolute beginner project manager at another company, my very first project was an absolute clusterfuck.
The customer basically wanted to scrape signups to their EventBrite events into their CRM system. The fuckery began before the project even started, when I was told my management that we HAD to use BizTalk. It didn't matter that we had zero experience with BizTalk, or that using BizTalk for this particular project was like using a stealth bomber to go down to the shops for a bottle of tequila (that's one for fans of Last Man on Earth). It's designed to be used by an experienced team of developers, not a small inexperienced 1-person dev team I had. The reason was for bullshit political reasons which I wasn't really made clear on (I suspect that our sales team sold it to them for a bazillion pounds, and they weren't using it for anything, so we had to justify us selling it to them by doing SOMETHING with it). And because this was literally my first project, I was young and not confident at all, and I wanted to be the guy who just got shit done, I didn't argue.
Inevitably, the project was a turd. It went waaay over budget and time, and didn't work very well. I remember one morning on my way to work seriously considering ploughing my car into a ditch, so that I had a good excuse not to go into work and face that bullshit project.
The good thing is that I learned a lot from that. I decided that kind of fuckery was never going to happen again.
A few months later I had an initial meeting with a potential customer (who I was told would be a great customer to have for bullshit political reasons) - I forget the details but they essentially wanted to build a platform for academic researchers to store data, process it using data processing plugins which they could buy, and commersialise it somehow. There were so many reasons why this was a terrible idea, but when they said that they were dead set on using SharePoint (SharePoint!!!) as the base of the platform, I remembered my first project and what happened.
I politely explained my technical and business concerns over the idea, and reasons why SharePoint was not a good fit (with diagrams and everything), suggested a completely different technology stack, and scheduled another meeting so they could absorb what I had said and revisit. I went to my sales and head of development and basically told them to run. Run fast, and run far, because it won't work, these guys are having some kind of fever dream, it's a clusterfuck in the making, and for some reason they won't consider not using SP.
I never heard from them again, so I assume we dropped them as a potential client. It felt amazing. I think that was the single best thing I did for that company.
Moral of the story: when technology decisions are made which you know are wrong, don't be afraid to stand up and explain why.3 -
developer makes a "missed-a-semicolon"-kind of mistake that brings your non-production infrastructure down.
manager goes crazy. rallies the whole team into a meeting to find "whom to hold accountable for this stupid mistake" ( read : whom should I blame? ).
spend 1-hour to investigate the problem. send out another developer to fix the problem.
... continue digging ...
( with every step in the software development lifecycle handbook; the only step missing was to pull the handbook itself out )
finds that the developer followed the development process well ( no hoops jumped ).
the error was missed during the code review because the reviewer didn't actually "review" the code, but reported that they had "reviewed and merged" the code
get asked why we're all spending time trying to fix a problem that occurred in a non-production environment. apparently, now it is about figuring out the root cause so that it doesn't happen in production.
we're ALL now staring at the SAME pull request. now the manager is suddenly more mad because the developer used brackets to indicate the pseudo-path where the change occurred.
"WHY WOULD YOU WASTE 30-SECONDS PUTTING ALL THOSE BRACES? YOU'RE ALREADY ON A BRANCH!"
PS : the reason I didn't quote any of the manager's words until the end was because they were screaming all along, so, I'd have to type in ALL CAPS-case. I'm a CAPS-case-hater by-default ( except for the singular use of "I" ( eye; indicating myself ) )
WTF? I mean, walk your temper off first ( I don't mean literally, right now; for now, consider it a figure of speech. I wish I could ask you to do it literally; but no, I'm not that much of a sadist just yet ). Then come back and decide what you actually want to be pissed about. Then think more; about whether you want to kill everyone else's productivity by rallying the entire team ( OK, I'm exaggerating, it's a small team of 4 people; excluding the manager ) to look at an issue that happened in a non-production environment.
At the end of the week, you're still going to come back and say we're behind schedule because we didn't get any work done.
Well, here's 4 hours of our time consumed away by you.
This manager also has a habit of saying, "getting on X's case". Even if it is a discussion ( and not a debate ). What is that supposed to mean? Did X commit such a grave crime that they need to be condemned to hell?
I miss my old organization where there was a strict no-blame policy. Their strategy was, "OK, we have an issue, let's fix it and move on."
I've gotten involved ( not caused it ) in even bigger issues ( like an almost-data-breach ) and nobody ever pointed a finger at another person.
Even though we all knew who caused the issue. Some even went beyond and defended the person. Like, "Them. No, that's not possible. They won't do such dumb mistakes. They're very thorough with their work."
No one even talked about the person behind their back either ( at least I wasn't involved in any such conversation ). Even later, after the whole issue had settled down. I don't think people brought it up later either ( though it was kind of a hush-hush need-to-know event )
Now I realize the other unsaid-advantage of the no-blame policy. You don't lose 4 hours of your so-called "quarantine productivity". We're already short on productivity. Please don't add anymore. 🙏10 -
So, rant!
So, global-huge-paradigm-shift project moving forward. Lots and lots of architects of multiple sites world-wide, stakeholders and business peeps and sub-corp manager and head-of-fucking-everything-of-multi-billion-dollar-CEO involved with different amounts of energy and passion.
Huge amount of money involved. Not only for the multi-year project endeavour but also in licensing costs for the years and years to come.
It's a big deal for the corporation.
And it's clowns everywhere. Leadership, project leads, technical project leads, architects. Am I one of them? I don't think so because everyone is mad at me. Since I cause trouble. Since I tend to say that I don't give a FUCK about the product being a Gartner Visionary player if you can't test the fucker properly...
Last week I attended a workshop in USA (I live in Europe) regarding this change which left me with a bad taste in my mouth. I am so far away from my comfort zone.
To these people (me?) get payed for this work? Is this really relevant? Why the FUCK did I need to go to a different continent? "The "Core team" need to be on site". Yeah, right. Fuck you Mr Project Leader, I can tell you are far, far away of being on-top of this thing...
Pointless.
It's pointless.
But I guess this is why you get payed.
Work.
Tomorrow is Tuesday and I think I will raise my hand yet again and explain to all I meet that I see HUGE risks with this project as it goes along right now. We kind of make things and that has to, you know, work. NOT making things for 1 hour is... well, that is really, really bad.
I give this project ten percent chance of succeeding above the set thresholds for all different areas/functionality. (I am sure the fuckers will alter the thresholds to show off a "successful project". Fuckers.2 -
This is long rant/story:
My manager conducts sync-up meetings regularly. The idea is to sync up all developers on current state of work. He does’t conduct stand-ups. He doesn't have time for it. He rather discusses on individual basis if we are blocked. The rule of the sync-up meeting is NOT to discuss any blockers or problems but simply explain each other what we are doing and how we plan next.
Sometime ago, the manager brought up and explained a new way of working in the sync-up meeting. At this point, a new developer in the team was absent due to sickness.
Today, there was a sync-up meeting and the manager started to question the new member about the newly introduced way of working. He was unaware of it and the manager never communicated this important information via email or any mode of communication available.
So, the conversation goes on as follows:
"Manager": — "Why didn’t you complete your task as per the new way of working?"
"Employee": — "Well, I've no idea. Am I supposed to do? I’ve been working as usual like any other"
"Manager": — "We have a new process and you have failed to follow it, so we’re late in delivering your work"
"Employee": — "I’ve already finished my work on time. I've raised a pull-request this morning"
"Manager": — "It doesn’t matter, it is not merged to main branch and so we can’t include your work in the release"
"Employee": — "I’ve no idea about the new process"
"Manager": — "Haven’t you asked around about what happened from previous meeting"
"Employee": — "Yes, I have. I was told which tasks were handled, but nothing about a new process"
"Manager": — "Aren’t you interested to learn it?"
"Employee": — "Why won’t I be interested? I was on a sick leave and I have no clue what happened here"
"Manager": — "What’s happened is past now, let’s not focus on it"
"Employee": — <Dumbfounded>
The Employee felt ashamed in front of everyone. He did his job but it didn’t pay off.
…. After an hour … the Employee had a talk with the Manager
"Employee": — "You shouldn’t have pointed me out in front of everyone. It made me feel real bad. You should have emailed this information if its important for the team."
"Manager": — "I have no idea what you’re talking about. When did I say so? I think you’ve a bright future in the team. You should be focusing on doing better things."
Employee goes back to work. A minute later, the Manager sends a PowerPoint screenshot of the process in the group chat.
**The Process**
It's about delivering release packages based on priorities defined by client. Each release package is a set of work items or requirements. Individual developers are assigned to work items. They are expected to deliver on planned delivery timelines in order to consider a work item into a release package.1 -
So this will be my first rant/story sorry if it gets too long.
So finished work and I was like finally some days off, went to bed, woke up the next morning, went to near city to take care of some work, went back and I noticed they were digging the ground near my place, as I've found out from neighbors they were changing some pipes, well ok no problem arrived home, sat on my PC to study a bit and do a bit gaming, but guess what?? NO INTERNET well ok contacted the ISP, the idiots told me it will take them 2 days to arrive WTF? is this 2018 or 1918?? I was so pissed off but ok the next day they called me that they arrived, they checked and said that they will need to fix some wires they will return the same day.. so I've waited few hours but no internet, the asholes didn't came, so the next day they arrived and guess what?! the idiots that digged the holes cut the wires, instead of fucking contacting the ISP to ask for supervisor to tell them where they can dig they didn't know what was the fire for and they thought oh well lets cut the fucking wire, and instead of stopping and contacting the ISP about their mistake they continued with the digging and cut the wire at 3 places, so the ISP at the end called the police, the plumbers that did the digging where just laughing, why do you laugh you primitive ashole, even 10 year old would first ask if it can continue if it finds something that he didn't know about it (I call primitive the person not the job title), and the best part is that the idiots not only they cut the wire at 3 places they also took part of it out of the ground and then they filled the holes back! Now I won't have internet for 2 fucking weeks, yes in 2018 this is happening, at that moment I was so pissed, but kept my cool and contacted the ISP to give me LTE USB stick to use it for the next 2 weeks, sadly they couldn't do that wtf??? So I asked politely who will pay the damage for me not working for 2 weeks and they said that they will gladly pay the damage.. So I was confused because that literally meant that they will compassed me for the 2 weeks, so I re-asked are they sure about that and they said yes, so lets see what it will be done, in the meantime I solved the internet problem by using my phone to access internet on the PC.. But still its amazing how primitive people can be and how ISP don't have alternative solutions for such cases, just to point out this sam ISP bragged how they will be among the first to bring 5G when it arrives... LOL4 -
Made a tiny-ass code change and commited it today. Put in a proper enough commit message as well (any dev would have understood).
Not 5 minutes later, my manager calls me (I was happy that my code was being reviewed so quickly) and asks "why did you make this change?" So I started explaining it to him. End of the discussion, turns out I had to give him 2 details: "it was a customer request" and "<insert client name here>".
Why did I ever try. Rather why didn't he try. -
ME - me, TM - teammate
I was just recruited to the company. We're starting new project based on few modules.
ME: So this module will do X and Y, I will use good old interfaces and design based on abstractions so that stuff does not get glued too much.
TM: But why? Make good old processor with all the logic and throw objects at it.
ME: B-but unit tests, decomposition and othet stuff...
TM: *insists and forces me to agree*
ME: *gets shit done his way, TM checks on code review and complains but generally doesnt give a fuck*
ME: Ok, its done. Lets get shit shipped.
TM: Well, we were just told by PM that we will need to process one more source with much different logic that does not fit current solution (he did meant GOD-PROCESSOR, idea of his).
ME: What do you mean? *injects another contextual implementation of processing logic to template method pattern solution*.
TM: I will tell PM you cant make it because of the implementation.
ME: But I just did it...
TM: Impossible, processor needs to be reimplemented. Get your shit together!
ME: *still doesnt get the shit about the god processor love*
TM: *rage quits next month*
ME: *module gets reused once more 2 month later, profit* -
I believe it is really useful because all of the elements of discipline and perseverance that are required to be effective in the workforce will be tested in one way or another by a higher learning institution. Getting my degree made me little more tolerant of other people and the idea of working with others, it also exposed me to a lot of topics that I was otherwise uninterested and ended up loving. For example, prior to going into uni I was a firm believer that I could and was going to learn all regarding web dev by maaaaaself without the need of a school. I wasn't wrong. And most of you wouldn't be wrong. Buuuuuut what I didn't know is how interesting compiler design was, how systems level development was etc etc. School exposed me to many topics that would have taken me time to get to them otherwise and not just on CS, but on many other fields.
I honestly believe that deciding to NOT go to school and perpetuating the idea that school is not needed in the field of software development ultimately harms our field by making it look like a trade.
Pffft you don't need to pay Johnny his $50dllrs an hour rate! They don't need school to learn that shit! Anyone can do it give him 9.50 and call it a day!<------- that is shit i have heard before.
I also believe that it is funny that people tend to believe that the idea of self learning will put you above and beyond a graduate as if the notion of self learning was sort of a mutually exclusive deal. I mean, congrats on learning about if statements man! I had to spend time out of class self learning discrete math and relearning everything regarding calculus and literally every math topic under the sun(my CS degree was very math oriented) while simultaneously applying those concepts in mathematica, r, python ,Java and cpp as well as making sure our shit lil OS emulation(in C why thank you) worked! Oh and what's that? We have that for next week?
Mind you, I did this while I was already being employed as a web and mobile developer.
Which btw, make sure you don't go to a shit school. ;) it does help in regards to learning the goood shit.5 -
Meeting at 'Derp & Co', the topic was what data model should send the back-end to frontend & app via API calls:
- Coworker: 'we should send the data structured like this for reasons'.
- Me: 'Yeah, this nested object.object.object should do the trick for the front end, but this will be a pain in the ass to convert to POJOs. Why not use something like idk better structure?'
<Mad/intrigued faces>
- CoworkerS: 'Why you need to use POJOs?'
- Me: <More Mad> 'cause I work with java in android... and we have/need/like objects?
<Captain Obvious left the room>
- CoworkerS: 'Oh yeah, well... we can do it the way you say'.
Why you need Objects... what is the next?
- Git? For what? Did not have the usb key from day one?2 -
These ignorant comments about arch are starting to get on my nerves.
You ranted or asked help about something exclusive to windows and someone pointed out they don't have that problem in arch and now you're annoyed?
Well maybe it's for good.
Next comes a very rough analogy, but imagine if someone posts "hey guys, I did a kg of coke and feeling bad, how do I detox?"
It takes one honest asshole to be like "well what if you didn't do coke?".
Replace the coke with windows.
Windows is a (mostly) closed source operating system owned by a for profit company with a very shady legal and ethical history.
What on earth could possibly go wrong?
Oh you get bsod's?
The system takes hours to update whenever the hell it wants, forces reboot and you can't stop it?
oh you got hacked because it has thousands of vulnerabilities?
wannacry on outdated windows versions paralyzed the uk health system?
oh no one can truly scrutinize it because it's closed source?
yet you wonder why people are assholes when you mention it? This thing is fucking cancer, it's hundreds of steps backwards in terms of human progress.
and one of the causes for its widespread usage are the savage marketing tactics they practiced early on. just google that shit up.
but no, linux users are assholes out to get you.
and how do people react to these honest comments? "let's make a meme out of it. let's deligitimize linux, linux users and devs are a bunch of neckbeards, end of story, watch this video of rms eating skin off his foot on a live conference"
short minded idiots.
I'm not gonna deny the challenges or limitations linux represents for the end user.
It does take time to learn how to use it properly.
Nvidia sometimes works like shit.
Tweaking is almost universally required.
A huge amount of games, or Adobe/Office/X products are not compatible.
The docs can be very obscure sometimes (I for one hate a couple of manpages)
But you get a system that:
* Boots way faster
* Is way more stable
* Is way way way more secure.
* Is accountable, as in, no chance to being forced to get exploited by some evil marketing shit.
In other words, you're fucking free.
You can even create your own version of the system, with total control of it, even profit with it.
I'm not sure the average end user cares about this, but this is a developer forum, so I think in all honesty every developer owes open source OS' (linux, freebsd, etc) major respect for being free and not being corporate horseshit.
Doctors have a hippocratic oath? Well maybe devs should have some form of oath too, some sworn commitment that they will try to improve society.
I do have some sympathy for the people that are forced to use windows, even though they know ideally isn't the ideal moral choice.
As in, their job forces it, or they don't have time or energy to learn an alternative.
At the very least, if you don't know what you're talking about, just stfu and read.
But I don't have one bit of sympathy for the rest.
I didn't even talk about arch itself.
Holy fucking shit, these people that think arch is too complicated.
What in the actual fuck.
I know what the problem is, the arch install instructions aren't copy paste commands.
Or they medium tutorial they found is outdated.
So yeah, the majority of the dev community is either too dumb or has very strong ADD to CAREFULLY and PATIENTLY read through the instructions.
I'll be honest, I wouldn't expect a freshman to follow the arch install guide and not get confused several times.
But this is an intermediate level (not megaexpert like some retards out there imply).
Yet arch is just too much. That's like saying "omg building a small airplane is sooooo complicated". Yeah well it's a fucking aerial vehicle. It's going to be a bit tough. But it's nowhere near as difficult as building a 747.
So because some devs are too dumb and talk shit, they just set the bar too low.
Or "if you try to learn how to build a plane you'll grow an aviator neckbeard". I'll grow a fucking beard if I want too.
I'm so thankful for arch because it has a great compromise between control and ease of install and use.
When I have a fresh install I only get *just* what I fucking need, no extra bullshit, no extra programs I know nothing about or need running on boot time, and that's how I boot way faster that ubuntu (which is way faster than windows already).
Configuring nvidia optimus was a major pain in the ass? Sure was, but I got it work the way I wanted to after some time.
Upgrading is also easy as pie, so really scratching my brain here trying to understand the real difficult of using arch.22 -
Working on a team to take functionality from the latest version of an old executable and put it into a new web-based app.
Coworker: I can't get the results to match so I'll just change the options I'm using in the original program until they match.
Me: That's not how this works. That's not how any of this works. Same options on both source and new app, and you should get identical results. Otherwise, there is a defect.
I walk over to look at what CW set up.
M: "Why do you have this box ticked? That option doesn't even exist in the new version."
CW: I don't know. It was there?
M: (trying not to lose my cool, sets up options the way they are supposed to be) This is actually a pretty simple program. It just queries the DB, so we have to make sure the queries and results are the same.
CW: (runs it) Still doesn't match.
M: What version of the source app are you using? Make sure it's the latest.
CW: I can't tell. There is no help/about menu.
At this point, I kinda want to quit and live in a cave.
M: You don't need that. Check the executable in Windows Explorer.
CW: What do you mean?
At this point, I'm sure I look like Anger from Inside Out. I show them how to do it (right click file, properties, etc), wondering how they got this far in their career without knowing how to do the simplest things.
M: (surprised and irritated) This... isn't the current version. It's two versions old.
CW: Well, I couldn't get the newest version to return the results that matched the test cases, so I used the version that did...
M: You can't do th... Why wou... How is that acc... (turns around and walks out to tell the manager he hired a moron)2 -
2 hour meeting to brainstorm ideas to improve our system health monitoring (logging, alerting, monitoring, and metrics)
Never got past the alerting part. Piss poor excuses for human being managers kept 'blaming' our logging infrastructure for allowing them to log exceptions as 'Warnings', purposely by-passing the alerting system.
Then the d-head tried to 'educate' everyone the difference between error and exception …frack-wad…the difference isn't philosophical…shut up.
The B manager kept referring to our old logging system (like we stopped using it 5 years ago) and if it were written correctly, the legacy code would be easier to migrate. Fracking lying B….shut the frack up.
The fracking idiots then wanted to add direct-bypass of the alerting system (I purposely made the code to bypass alerting painful to write)
Mgr1: "The only way this will work is if you, by default, allow errors to bypass the alerting system. When all of our code is migrated, we'll change a config or something to enable alerting. That shouldn't be too hard."
Me: "Not going to happen. I made by-passing the alert system painful on purpose. If I make it easy, you'll never go back and change code."
Mgr2: "Oh, yes we will. Just mark that method as obsolete. That way, it will force us to fix the code."
Me: "The by-pass method is already obsolete and the teams are already ignoring the build warnings."
Mgr1: "No, that is not correct. We have a process to fix all build warnings related to obsolete methods."
Mgr2: "Yes. It won't be like the old system. We just never had time to go back and fix that code."
Me: "The method has been obsolete for almost a year. If your teams haven't fixed their code by now, it's not going to be fixed."
Mgr1: "You're expecting everything to be changed in one day. Our code base is way too big and there are too many changes to make. All we are asking for is a simple change that will give us the time we need to make the system better. We all want to make the system better…right?"
Me: "We made the changes to the core system over two years ago, and we had this same conversation, remember? If your team hasn't made any changes by now, they aren't going to. The only way they will change code to the new standard is if we make the old way painful. Sorry, that's the truth."
Mgr2: "Why did we make changes to the logging system? Why weren't any of us involved? If there were going to be all these changes, our team should have been part of the process."
Me: "You were and declined every meeting and every attempt to include your area. Considering the massive amount of infrastructure changes there was zero code changes required by your team. The new system simply worked. You can't take advantage of the new features which is why we're here today. I'm here to offer my help in any way I can with the transition."
Mgr1: "The new logging doesn't support logging of the different web page areas. Until you can make that change, we can't begin changing our code."
Me: "Logging properties is just a name+value pair dictionary. All you need to do is standardize on a name and how you add it to the collection."
Mgr2: "So, it's not a standard field? How difficult would it be to change the core assembly? This has to be standard across all our areas and shouldn't be up to the developers to type in anything they want."
- Frack wads smile and nod to each other like fracking chickens in a feeding frenzy
Me: "It can, but what will you call this property? What controls its value?"
- The look I got from both the d-bags I could tell a blood vessel popped.
Mgr1: "Oh…um….I don't know…Area? Yea … Area."
Mgr2: "Um…that's not specific enough. How about Page?"
Mgr1: "Well, pages can cross different areas, and areas cross different pages…what do you think?"
Me: "Don't know, don't care. It's up to you. I just need a name."
Mgr2: "Modules! Our MVC framework is broken up in Modules."
DevMgr: "We already have a field for Module. It's how we're segmenting the different business processes"
Mgr1: "Doesn't matter, we'll come up with a name later. Until then, we won't make any changes until there is a name."
DevMgr: "So what did we accomplish?"
Me: "That we need to review the web's logging and alerting process and make sure we're capturing errors being hidden as warnings."
Mgr1: "Nooo….we didn't accomplish anything. This meeting had no agenda and no purpose. We should have been included in the logging process changes from day one."
Mgr2: "I agree, I'm not sure why we're here"
Me: "This was a brainstorming meeting as listed in the agenda. We've accomplished 2 of the 4 items. I think we've established your commitment to making the system better. Thank you all for coming."
- Mgr1 and 2 left without looking at me or saying a word.1 -
Of course, I just swiped the wrong way on my fucking laptop trackpad and list everything I just typed. FUCKING MARVELOUS.
TL;DR: Teacher stopped me from being productive. Principal almost called cops on me. Nearly threw chair at librarian.
So I'm at school yesterday, and we have a presenter in 2nd hour, so naturally, I'm gonna be on my computer doing things for other classes at the same time. Efficiency. Teacher doesn't like it, I refuse to put the computer away telling her that I'll be more productive and still pay attention, which HAS BEEN PROVEN MIND YOU, but she ends up calling security on me and I get sent down to the principal's office.
I talk to him, and he says 'Yeah, I know it's in the way, but you have to follow the directive given by the teachers.' Fine, fuck it. Won't go to her class for third hour. (I have her twice in a row for two different classes.) Next day.
I walk in, asking her if she's gonna do the same thing she did yesterday, hoping that she realized her error and will fix it, but no. She says I STILL can't have the computer out. I'm sorry, do you not realize I have 6 other fucking classes, most of which are required to graduate, unlike YOURS, as well as a FUCKING COLLEGE CLASS TONIGHT?! She gives the ultimatum. 'Obey or leave.' Fine, I'll leave. I go to the principal's office again, he must have a stick up his ass or something today because he's not budging. We argue for a while and he gives a WORSE ultimatum: 'Obey, Go to the Library, In House Suspension, or I'll call the police.' What the actual FUCK MAN?! You're gonna call the POLICE on a NONVIOLENT STUDENT?! Are you fucking MAD? I keep trying to tell him that there's an easy solution to this, but as he's getting up to call the cops, I say 'Fine! I'll go to the library!' He follows me over to make sure I don't kill anyone on the way.
I slam the door to the library open, and when I walk in, the librarian is there at her computer, and she asks 'Where are you coming from?' 'Principal!' 'I need a pass-' 'Well, I'm sorry, I can't exactly get anything for you right now, I was just sent down here.' She says 'Either way, I need some kind of note or pas-' 'Listen, I'm not in the mood for any of this right now. Please, just leave me be.' She then tries to say something, but I cut her off quickly, 'Just back off and leave me alone right now. The more you push it, the more you're gonna make me want to throw this chair!' Imagine the volume just gradually getting louder on that last one. She quickly runs out and talks to the security desk or something, which is right outside the library door, but she's the only one who comes in, thankfully. I was expecting to be fucking dragged out for no good reason. I'm loud, not violent. I have no history of violence.
So yeah. Here I am in the school library, angrily tapping away at my keyboard, trying not to throw the entire table to the fucking moon. All because this broken-ass public school system has no idea how to deviate from the norm when it's actually productive and efficient to do so. And now, the obligatory:
FUCKING PIECES OF SHIT WHY DON'T YOU REALIZE THAT YOU ARE COMPLETELY WRONG IN EVERY SINGLE THING YOU ARE DOING YOU IDIOTIC SCUM-FILLED MEAT SACKS OF NO FORSEEABLE VALUE! FUCK!1 -
Do anybody remember when i wrote a rant about the IT teacher in my high school?
Few months ago we got the results from final exams! (we have precentage based grades)
Another thing to remember:
You can pick basic or extended version of the every test you take.
Everybody has to get at least 30% on basic exams (they are nessesary for everybody) to graduate from the school. The extended exams give you more points at university and they are not mandatory.
In addition to that extended ones dont have the lower limit
The IT exam has only the extended version (because its not mandator, you pick it yourself). It is pretty easy: just basic algorithms, basic C++ programs and general PC things.
I didnt take the IT class because i thougt i can learn much more at home. My friend took it. He is very good. He uses linux he wants to become a pen tester. I know he is worth getting 100% on that extended IT exam. (We did a lot of projects thogether)
Well... NOBODY GOT MORE THAN 20% on that exam! WTF!
That POS teacher should die in that win xp IT class with all ethernet cables stuck in his ass!
He didnt teach anything useful about algorithms to anybody! And that was the easiest and the most important part on the exam!
In addition to that people had to do few tasks on pc as well! And one of those tasks could been a picture in gimp BUT THE GIMP DIDNT EVEN WORK ON THOSE PC'S!
Algorithms are easy! That son of a twat didnt even understand it himself! That is why im telling everybody in my town to NOT go to that hight school for IT exam!
I dont want anybody to waste their life trying to learn something useful when that fucking bitch dosent understand anything!
That teacher is lucky. My friend got rejected from studing CS on university (due to the shit score) but he at least got accepted to study math.
I hope he will be able to continiue his dev dream.3 -
I hate the idea of dog whistles.
For those who do not know what I am talking about: A dog whistle, next to being a physical object you blow in that makes a sound dogs can hear, but is too high in frequency for most humans to hear, can also refer to a hidden sign for a group or ideology that is supposed to be only known by its members.
Here, in Germany, we usually use it for Nazi groups. Hey, 88 is a dog whistle for Nazis, because, the 8th letter in the alphabet is the 'H', and 'HH' stands for Heil Hitler. Alright, got it.
But how the fuck am I supposed to know it? I am not a member of those groups. Well, other people, who look at them tell closely, told me. In a way, you want me to keep up with them, so I can know the newest dog whistles to avoid them?
Another famous one is the attempt to claim the okay sign is a symbol for white power. But here I stand and say, no. I was making this sign all along. I did not signal white power. I was signalling that everything is okay.
And isn't that racist in the first place. Black people cannot swim stereotype. And then they choose the white power signal from diver's sign language? Because they knew, no black person was a diver? Don't mind me, I am just taking the piss.
Then there was Elon Musk. I don't like Elon, I think he's an idiot. I also think that he made it possible for lots of tax money to flow into SpaceX and pay really smart people to work on rockets, which I like. Somehow, in a modern world, we have to do that instead of just funding NASA. Anyway, he is accused of doing a Nazi salute.
But if that was a Nazi salute, that was the sloppiest Nazi salute ever. It was akin to a dog whistle to a Nazi salute. Every proper Nazi should tell him how embarrassing his salute was. But instead, the Overton window on a Nazi salute widens.
We should make fun of him not being capable of doing it right. He would then obviously publicly state he is no Nazi. And some Nazis will believe them.
Ever wondered why in war some national leaders will tout obvious lies? That's because, often due to an information bubble, sometimes because of confirmation bias, many will believe them. If they said the truth, every single one listening would know the truth. If they lied, there is a substantial part of the population ill-informed or invested enough who wants to believe them. And if that's a preferable state, a leader will lie.
Why do we assume that dog whistles are just something we don't understand, but somehow, without writing publicly available guides or news broadcast spelling it out, the subgroup that uses that dog whistle, perfectly understands its meaning.
Recently AfD, German right wing party, had a party conference, and the number and position of the flags on stage was somehow aligned with the number of... what was it... SS branches or something in the third reich? Come one, you're reaching now. You tell me that right wingers are so well informed history buffs that they would ace any history exam about it and equate every subliminal message?
I probably had a dozen dog whistles in this text that I don't know of. Do you know how those groups actually learn about their own dog whistles? Standard media tells them that is their groups dog whistle and they copy it. Copy cat. Funny side note, that's how satanism actually started. Copy cats from stories from the church. They tried to scare people about those evildoers. At least that's one popular hypothesis. Aleister Crowley, not Church of Satan satanism.
Anyway, I hate dog whistles. We commit them constantly, we cannot avoid it and it incriminates everyone. It keeps broadening the definition of every forbidden/frowned upon action. It's shit. If you argue dog whistle, I think you're a moron.42 -
I dunno if you gents remember the Nickelodeon show known as Drake and Josh.
It was pretty big in Mexico and the U.S.
Well, one of the characters from that show is the singer/actor Drake Bell.
For a while, Drake Bell would **constantly** tweet about how much Justin Bieber sucks.
I aint denying that Justin Bieber sucks, i don't like his music at all.
But the constant attacks came out as jealousy, at least to me.
What does this has to do with development or even computers? Well this is EXACTLY how I feel about Louis Rossman CONSTANTLY making videos about apple products.
We get it man we really do, sadly for a lot of us the only way to get ios development done is through a fucking Mac
EVEN if his whiny ass is right about the hardware not being top notch and all that shit I AM still not able to explain a 2013(early...as in january) macbook pro still working with literally NO fucking problems. Before that the other macbook was just changed because we wanted the 2013 model. The thing worked, the one before did so too and the 2017 model that I have works, amazingly so i will add.
Still, the army of dell,hp and lenovo laptops that I've had before just died or are not functioning properly. Either it is my shit luck or Apple's "shitty hardware" got something really fucking right.
I think its retarded really. If you don't like them then fine, you don't have to, personally I fucking love all computers and os, but I don't get fanboys hating for the sake of hate.
the fuck you care if I spend 2500 on a computer? I would the same shit for your mom and the computer would last me longer.
Does owning multiple macs make me better than you? No
Does this mean that you are piss poor and can't afford shit and that is why you are hating? No
Will I call you <insert number of insults> gor your choice of pc or os? No
What is retarded is this: you all are DEVELOPERS(at least a good chunk) and your ass better fucking know that some people USE a certain tool because IT IS THE RIGHT ONE FOR THE JOB.
It is a damn fine operating system, a really good computing experience. It ain't your taste? Fine, das cool, but for fucks sake it does not mean that the other people are idiots or whatever.
Grow the fuck up and get yourself an opinion.20 -
Sooooo ok ok. Started my graduate program in August and thus far I have been having to handle it with working as a manager, missing 2 staff member positions at work, as well as dealing with other personal items in my life. It has been exhausting beyond belief and I would not really recommend it for people working full time always on call jobs with a family, like at a..
But one thing that keeps my hopes up is the amount of great knowledge that the professors pass to us through their lectures. Sometimes I would get upset at how highly theoretical the items are, I was expecting to see tons of code in one of the major languages used in A.I(my graduate program has a focus in AI, that is my concentration) and was really disappointed at not seeing more code really. But getting the high level overview of the concepts has been really helpful in forcing me to do extra research in order to reconnect with some of the items that I had never thought of before.
If you follow, for example, different articles or online tutorials representing doing something simple like generating a simple neural network, it sometimes escapes our mind how some of the internal concepts of the activity in question are generated, how and why and the mathematical notions that led researchers reach the conclusions they did. As developers, we are sometimes used to just not caring about how sometimes a thing would work, just as long as it works "we will get back to this later" is a common thing in most tutorials, such as when I started with Java "don't worry about what public static main means, just write it up for now, oh and don't worry about what System.out.println() is, just know that its used to output something into bla bla bla" <---- shit like that is too common and it does not escape ML tutorials.
Its hard man, to focus on understanding the inner details of such a massive field all the time, but truly worth it. And if you do find yourself considering the need for higher education or not, well its more of a personal choice really. There are some very talented people that learn a lot on their own, but having the proper guidance of a body of highly trained industry professionals is always nice, my professors take the time to deal with the students on such a personal level that concepts get acquired faster, everyone in class is an engineer with years of experience, thus having people talk to us at that level is much appreciated and accelerates the process of being educated.
Basically what I am trying to say is that being exposed to different methodologies and theoretical concepts helps a lot for building intuition, specially when you literally have no other option but to git gud. And school is what you make of it, but certainly never a waste.2 -
With a recent HAProxy update on our reverse proxy VM I decided to enable http/2, disable TLS 1.0 and drop support for non forward-secrecy ciphers.
Tested our sites in Chrome and Firefox, all was well, went to bed.
Next morning a medium-critical havock went loose. Our ERP system couldn't create tickets in our ticket system anymore, the ticket systems Outlook AddIn refused to connect, the mobile app we use to access our anti-spam appliance wouldn't connect although our internal blackboard app still connected over the same load balancer without any issues.
So i declared a 10min maintenance window and disabled HTTP/2, thinking that this was the culprit.
Nope. No dice.
Okay, i thought, enable TLS 1.0 again.
Suddenly the ticket system related stuff starts to work again.
So since both the ERP system and the AddIn run on .NET i dug through the .NET documentation and found out that for some fucking reason even in the newest .NET framework version (4.7.2) you have to explicitly enable TLS 1.1 and 1.2 or else you just get a 'socket reset' error. Why the fuck?!
Okay, now that i had the ticket system out of the way i enabled HTTP/2 and verified that everything still works.
It did, nice.
The anti-spam appliance app still did not work however, so i enabled one non-pfs cipher in the OpenSSL config and tested the app.
Behold, it worked.
I'm currently creating a ticket with them asking politely why the fuck their app has pfs-ciphers disabled.
And I thought disabling DEPRECEATED tech wouldn't be an issue... Wrong... -
For the one I currently have. Spent about 2 weeks looking to get as much of my PHP skillset in the right place since I knew PHP was their main technology as well as JS, C# and VB.NET, we seldom use them tbh, and it is mostly extension or maintenance stuff, so I focused on PHP.
I was not panicking, I rarely ever do, but my body tends to disagree with my state of mind and I can feel myself trembling in certain situations, such as the interview.
The interview was on Monday and my last day of preparation was Sunday (obviously) so what I did was drank a lot of beer and played videogames, I just wanted to take my mind off things. I was, and have always been annoyingly confident in myself and could not understand why I was feeling so nervous internally.
Everything went away when the manager came to greet me, lovely looking gal with an awesome sense of style and a big smile, we clicked instantly and to this day the place is kinda like my second home, as hectic as it is to work in an institution of this size it is really my peace and quiet zone. The entire I.T department is a big family, before the pandemic we would go to bbqs together all the time, would go to a friend's ranch to shoot shit and just chill, parties and gatherings, it really is a nice place to be at and they take the "we are family" very fucking seriously, I fucking love it. The boss lady ain't here no more, but she recommended me for the position and well, here I am.
I severely hope everyone here finds the same kind of place, there are a lot of assholes in this industry and a lot of places that seem very into the idea of making you absolutely miserable with no chance of leveling up, I know because all other jobs previous to this place was the same way for me.
Have faith, keep them chins up, and don't ever fucking let anyone make you think you are something you are not. You glorious beautiful basterds!3 -
Imagine a web way ahead of our time where its size goes beyond our imagination...
This is my first rant, and I'll cut to the chase! I don't like how web currently stands. Here's what makes me angry the most altough I know there's a myriad of solutions or workarounds:
- A gazillion credentials/accounts/services in your lifetime.
- Everyone tries to reinvent the wheel.
- There's no single source of truth.
- Why the fuck there's so much design in a vision that started as a network of documents? Why is it that we need to spend time and energy to absorb the page design before we can read what we are after?
- What's up with the JS front end frameworks?! MB's of code I need to download on every page I visit and the worse is the evaluation/parsing of it. Talk about acessibility and the energy bills. I don't freaking need a SPA just give a 20-50ms page load and I'm good to go!
- I understand that there's a whole market based on it but do we really need all that developer tools and services?
- Where's our privacy by the way? Why the fuck do I need ads? Can't I have a clue about what I wan't to buy?
Sticking with this points for now... Got plenty more to discuss though.
What I would like to see:
A unique account where i can subscribe services/forums/whatever. No credentials. Credentials should be on your hardware or OS. Desktop Browser and mobile versions sync everything seemlesly. Something like OpenID.
Each person has his account and a profile associated where I share only what I want with whom I want when I want to.
Sharing stuff individually with someone is easy and secure.
There's no more email system like we know. Email should be just email like it started to be. Why the hell are we allowing companies to send us so much freaking "look at me now, we are awesome", "hey hey buy from me".. Here's an idea, only humans should send emails. Any new email address that sends you an email automatically requests your "permission" to communicate with you. Like a friend request.
Oh by the way did I tell you that static mail is too old for us? What we need is dynamic email. Editing documents on the fly, together, realtime, on the freaking email. Better than mail, slack and google docs combined.
In order for that to work reasonably well, the individual "letter" communication would have to be revamped in a new modern approach.
What about the single source of truth I talked about? Well heres what we should do. Wikipedia (community) and Larry Page (concept) gave us tremendous help. We just need to do better now.
Take the spirit of wikipedia and the discoverability that a good search engine provides us and amp that to a bigger scale. A global encyclopedia about everything known to mankind. Content could be curated from us all just like a true a network.
In this new web, new browser or whatever needed to make this happen I could save whatever I want, notes, files, pictures... and have it as I left it from device to device.
Oh please make web simple again, not easy just simple and bigger.
I'm not old by the way and I don't see a problem with being older btw.
Those are just my stupid rants and ideas. They are worth nothing. What I know for sure is that I'll do something about or fail trying to.12 -
If you've ever tried using Go plugins raise your hand.
If you've ever tried doing plugins in Go, raise your hand.
If you think that the following rant will be interesting, raise your hand.
If you raised your hand, press [Read More]:
This is a tale of pain and sorrow, the sorrow of discovering that what could be a wonderful feature is woefully incomplete, and won't be for a very long time...
Go plugins are a cool feature: dynamically load pre-compiled code, and interact with it in a useful and relatively performant way (e.g. for dynamically extending the capabilities of your program). So far it sounds great, I know right?
Now let me list off some issues (in order of me remembering them):
1. You can't unload them (due to some bs about dlopen), so you need to restart the application...
2. They bundle the stdlib like a regular Go binary, despite the fact that they're meant to be dynamic!
3. #2 wouldn't be so bad if they didn't also require identical versions of all dependencies in both binaries (meaning you'd need to vendor the dependencies, and also hope you are using the right Go version).
4. You need to use -trimpath or everything dies...
All in all, they are broken and no one is rushing to fix it (literally, the Go team said they aren't really supporting it currently...).
So what other options are there for making plugins in Go?
There's the Hashicorp method of using RPC, where you have two separate applications one the plugin, one the plugin server, and they communicate over RPC. I don't like it. Why? Because it feels like a hack, it's not really efficient and it carries a fear of a limitation that I don't like...
Then we come to a somewhat more clever approach: using Lua (or any other scripting language), it's well known, it's what everyone uses (at least in games...). But, it simply is too hard to use, all the Go Lua VMs I could find were simply too hard to set up...
Now we come to the most creative option I've seen yet: WASM. Now you ask "WASM!? But that's a web thing, how are you gonna make that work?" Indeed, my son, it is a web thing, but that doesn't mean I can't use it! Someone made a WASM VM for Go, and the pros are that you can use any WASM supporting language (i.e. any/all of them). Problem inefficient, PITA to use, and also suffers from the same issues that were preventing me from using Lua.
Enter Yaegi, a Go interpreter created by the same guys who made (and named) Traefik. Yes, you heard me right, an INTERPRETER (i.e. like python) so while it's not super performant (and possibly suffering from large inefficiency issues), it's very easy to set up, and it means that my plugins can still be written in Go (yay)! However, don't think this method doesn't have its own issues, there's still the problem of effectively abstracting different types of plugins without requiring too much boilerplate (a hard problem that I'm actively working on, commits coming soon). However, this still feels to be the best option.
As you can see, doing plugins in Go is a very hard problem. In the coming weeks (hopefully), I'm going to (attempt to at least) benchmark all the different options, as well as publish a library that should help make using Yaegi based plugins easier. All of this stuff will go (see what I did there 😉) in a nice blog post that better explains the issues and solutions. But until then I have some coding to do...
Have a good night(/day)!13 -
so i am on notice period and suddenly my manager has realised that there are a lot of tasks that i have to pickup. well fuck this guy.
i was initially dumb enough to think that i leaving is a bad thing,and i should be doing everything to make the transition easier. the task was also interesting enough , as we were trying to add a new and complex feature and i was the main dev there.
so i started at full pace. i would work on my tasks for hours , even missing on my personal projects. but since last week he would keep adding new tickets in my jira boards every few days , followed by a quick huddle telling how this is a very small and high priority ticlet and i should look at that first.
and me being me, i would not only just finish those small tickets in time, but have a progress on my major feature, as well as answer doubts of other team mates and attend meetings.
--------
i always forget how hypnotising this work culture usually get. the above scenario that i explained? i have no problem with that in a general day. i love to work, solve problems and help others. but these are no normal days, this is my fuckin notice period.
And i am here coz of a reason. if they rely on me so much, why did they forced me to relocate when i just can't? why don't they gove me a lucrative salary + worthy relocation benefits ? fuck them. i even have to serve for a fucking 60 days coz they are not willing to reduce my notice period .
fake promises everytime.
"you don't worry about different office mentioned in your offer letter. we will always keep the environment remote" ~ lie
"even if we go wfo, our company will open an office in your city too, your city is the capital and we had an office there before" ~ lie
"your notice period will get reduced, dont worry about the 60 days" - another fucking lie
______
notice period experts, i need some devil advice to not get exploited by a lier corp. how to utilise my notice period and what should he the excuses to not attend any nloody meetings?9 -
TLDR; College group projects suck, not because the work, but the people in your group will make or break you. Fuck having 1 week to do this assignment.
Sometimes working with other students on group projects is great, they actually know how to create a merge a git branch. I've had a decent partner once during my 3 years at university so far. This last project takes the cake on idiots I've worked with...so far at least... It was me and two others, we'll call them Thing1 and Thing2 for now. Anyway so the 3 of us had a week to implement a very rudimentary Invoice system; fine, easy enough. We divided up the work and 'started'.
All seemed to be going well, no complaints or cries for help all week. Until 4 hours before we submit the assignment; Thing 1 sends me a DM saying all of Thing 1's work is useless full of bugs and just shouldn't be integrated with the rest of the code. Umm fine? I guess? wtf?! why did this have to come out last minute?! We could have explained to Thing 1 what's going on and gotten him/her up to speed on everything. Believe it or not, I was sorta ok with this? I mean thing 1 hadn't pushed anything to the repo yet. I mean literally nada, Thing 1 is a collaborator on the repo that has contributed nothing. Seeing as how Thing 1 was contributing nothing I had already started to cover our ass a began Thing 1's work.
That's not even what's pissed me off... at least thing 1 had the gall to message me to say "idk..wtf is going on...continue without me". Thing 2 arguably made my time with the project worse. His code was nothing but garbage...every time...literally spent more time deciphering his incoherent bullshit more than I did rewriting his mess. I shit you not he wrote out this method, and tells the group he's "finally got it fixed and working":
public static float updateTotal(float newValue)
{
total = updateTotal(newValue);
return total;
}
How tf did he test this to see if its working?! I'm a novice and can already see the infinite loop here. You called your method within that method's own definition, what did you expect to happen.
I managed to get things 75% working and turned in 5 mins before the cut off.
Thankfully Thing 1 emailed the Proff as well, hopefully he won't tank my grade too bad. I'm so glad to be done with this assignment, fingers crossed there's no more group work.4 -
Well, I am not sure whether this is supposed to be about worst experience as a reviewER or a reviewEE so I'ma do both. First as a reviewer.
So, on my first project in this company, I introduced automated build scripting (read: suggested, was "volunteered" to do it, then had to bust my ads to get it done). Prior to this, our process was run the thing in Visual Studio a bunch of times (don't ask) and package the resulting files. Well, new requirements made this not sustainable.
So after many many meetings in which I assured my co-workers that the script wouldn't cock up and go sideways and format our server (HOW???) and showed them how to work it AND added all the features they requested. I finally send the script out for code review. Oh the joy. Questions like: "why did you implement this?" Came from the guy who told me to implement it. "Can you change the formatting?" I checked and no. "Why isn't this to the code standard?" Because the code standard doesn't include scripting languages.
And here is the piece that takes the whole piss soaked shitsicle pie "I don't understand why we're doing this in the first place. We have a build process already, why do we need a new one?" FUCKING REALLY?!?!? YOU WERE IN THE GODS DAMNED MEETING WHERE WE DECIDED TO DO THIS!!! SET OUT THE REQUIREMENTS!!! LITERALLY EVERYTHING TO DO WITH THIS SCRIPT YOU WERE THERE AND YOU'RE ASKING WHY WE'RE DOING IT NOW!?!?! Fucking hell. I forced it through anyway because I had the higher ups all signed off on it, but seriously. Just because we're doing something new that slightly inconveniences you, doesn't mean it doesn't need to be done. Stop being afraid of change.
Side note: these people actually would regularly hold up process and product improvement because change is scary.2 -
Why do people who put camera's on always insist others must do so as well? I don't mind when it's a special meeting like a retro or some form of team building thing, but I cannot be assed during standup - that MFer is meant to be over after 10 minutes. You guys go on an hour-long tangent, while I'm busy writing code, chatting to people and getting shit done, do you really need to see me not paying attention to the issues with the PHP project that are there because client X did something stupid. I'm already rolling my eyes while listening right now. Also, I don't want to put a "good" shirt on for 20 minutes to an hour meeting.17
-
So this might be a very long post , but i am sure most of you can relate to it .
So , the year end . Time of joy and appraisals right?You have slogged your ass off the entire year and are expecting amazing ratings.Then boom , your piece of shit sadist manager starts of his review by saying 'there are worrysome things to discuss' after not saying shit for the entire year . I am pretty new to corporate , in fact 1 year old , still managed to handle devops for a team of 130+ , majority of whom have no work apart from playing a blame game and indulging in cheap politics. I mean , bro , I am literally your son's age , i dont see the point in playing this cheap shit with me.On top of that this sadist and borderline piece of shit manager has the audacity to say that I did not raise any blockers , while I have CCed him in every fucking mail possible.How big of an a****** can you be bro?
I counter his points for 40 45 mins straight ,leaving him stuck without words for solid 10 to 15 seconds many times during the 'review meet'. This guy is in the same place working on the same shit code , which 90% of this community can't even think of. Every thing is bloody manual and apparently ' I should have tried to streamline the entire f**** process' . Cool bro , why not open a startup while I am at it ?
Then this piece of poop gives me a rating which is just above the inconsistent performer bracket :) .
I just dont get the points what do these people get by giving shit ratings and not even having valid points to back up their fuck all arguments.This guy , throughout the duration of the call did not say 1 (bloody 1 ) good thing about my efforts. Past context is majority of the smart people who were literally running their pods single handedly , were under him and were fed up with not getting hikes and appraisals.Apart from me ,everyone resigned and left with hikes as high as 50% (LOL right).
But I have a year of experience and its really difficult to perform well in 4 rounds of bs compititive coding rounds, after which I get the generic ' oh you did well bro but we are moving on with other candidates' (FFS) .
I pray that even my worst enemies don't get such managers and I hope he rots in hell.
Amen and sorry for the cussing :) -
So good to see flash finally be put to pastor. Am I sad no flash sucked from a developer standpoint but even more from a business standpoint! Why? Here’s why!
....Yes it was fast in the sense of quickly getting content out and functioning BUT this ment you are at the mercy of Adobe / Macromedia (depending on the timeframe) for support AND mercy of the company whom create the browsers for support.
Meaning your product is fully reliant on others for existence and can easily not exist if one of two other beings choose.
For developers shame on you for accepting this you should never have supported this.. if you did it was just for a job you are suppose to be experts in your field and when management came to you for guidence you allowed this technology to be used rather than saying no this isn’t good! It’s too risky...
Fuck... how many people choose a career path that made them flash only developers.. well guess what becuase you niched yourself now your out of a job... rethinking now?
CAN ANY OF YOU TELL ME WHAT OTHER WIDLY USED TECHNOLOGY IS RELIANT ON A SEPARATE ENTITY?!
geee it would be a shame if one day that technology was phased out or no longer supported and then a date was picked and boom shutdown... geee that would suck...
I remember for years before it was announced it would be ending ... I said development around flash should be avoided at all costs because of it’s reliance on someone else for your product to function and exist...
Let this be a foreshadowing/ warning... learning experience/ AMAGE.. to those who use similarly situated technologies...
Developers you were warned.
Businesses you were warned.15 -
!rant
For all of youse that ever wanted to try out Common Lisp and do not know where to start (but are interested in getting some knowledge of Common Lisp) I recommend two things:
As an introductory tutorial:
https://lisperati.com/casting.html/
And as your dev environment:
https://portacle.github.io/
Notice that the dev environment in question is Emacs, regardless of how you might feel about it as a text editor, i can recommend just going through the portacle help that gives you some basic starting points regarding editing. Learn about splitting buffers, evaluating the code you are typing in order for it to appear in the Common Lisp REPL (this one comes with an environment known as SLIME which is very popular in the Lisp world) as well as saving and editing your files.
Portacle is self contained inside of one single directory, so if you by any chance already have an Emacs environment then do not worry, Portacle will not touch any of that. I will admit that as far as I am concerned, Emacs will probably be the biggest hurdle for most people not used to it.
Can I use VS Code? Yes, yes you can, but I am not familiar with setting up a VSCode dev environment for Emacs, or any other environment hat comes close to the live environment that emacs provides for this?
Why the fuck should I try Common Lisp or any Lisp for that matter? You do not have to, I happen to like it a lot and have built applications at work with a different dialect of Lisp known as Clojure which runs in the JVM, do I recommend it? Yeah I do, I love functional programming, Clojure is pretty pure on that (not haskell level imo though, but I am not using Haskell for anything other than academic purposes) and with clojure you get the entire repertoire of Java libraries at your disposal. Moving to Clojure was cake coming from Common Lisp.
Why Common Lisp then if you used Clojure in prod? Mostly historical reasons, I want to just let people know that ANSI Common Lisp has a lot of good things going for it, I selected Clojure since I already knew what I needed from the JVM, and parallelism and concurrency are baked into Clojure, which was a priority. While I could have done the same thing in Common Lisp, I wanted to turn in a deliverable as quickly as possible rather than building the entire thing by myself which would have taken longer (had one week)
Am I getting something out of learning Common Lisp? Depends on you, I am not bringing about the whole "it opens your mind" deal with Lisp dialects as most other people do inside of the community, although I did experience new perspectives as to what programming and a programming language could do, and had fun doing it, maybe you will as well.
Does Lisp stands for Lots of Irritating Superfluous Parentheses or Los in stupid parentheses? Yes, also for Lost of Insidious Silly Parentheses and Lisp is Perfect, use paredit (comes with Portacle) also, Lisp stands for Lisp Is Perfect. None of that List Processing bs, any other definition will do.
Are there any other books? Yes, the famous online text Practical Common Lisp can be easily read online for free, I would recommend the Lisperati tutorial first to get a feel for it since PCL demands more tedious study. There is also Common Lisp a gentle introduction. If you want to go the Clojure route try Clojure for the brave and true.
What about Scheme and the Structure and Interpretation of Computer Programs? Too academic for my taste, and if in Common Lisp you have to do a lot of things on your own, Scheme is a whole other beast. Simple and beautiful really, but I go for practical in terms of Lisp, thus I prefer Common Lisp.
how did you start with Lisp?
I was stupid and thought I should start with it after a failed attempt at learning C++, then Java, and then Javascript when I started programming years ago. I was overwhelmed, but I continued. Then I moved to other things. But always kept Common Lisp close to heart. I am also heavy into A.I, Lisp has a history there and it is used in a lot of new and sort of unknown projects dealing with Knowledge Reasoning and representation. It is also Alien tech that contains many things that just seem super interesting to me such as treating code as data and data as code (back-quoting, macros etc)
I need some inspiration man......show me something? Sure, look for a game called Kandria in youtube, the creator, Shimera (Nicolas Hafner) is an absolute genius in the world of Lisp and a true inspiration. He coded the game in Common Lisp, he is also the person behind portacle. If that were not enough, he might very well also be Shirakumo, another prominent member of the Common Lisp Community.
Ok, you got me, what is the first thing in common lisp that I should try after I install the portacle environment? go to the repl and evaluate this:
(+ 0.1 0.2)
Watch in awe at what you get.
In the truest and original sense of the phrase (MIT based) "happy hacking!"9 -
There has been a post today about the existence of too many js frameworks. Which reminds me of this awesome post https://hackernoon.com/how-it-feels...
At first I thought someone was corpseposting, as it is my understanding that the js ecosystem is calming down a bit. But then I noticed that post got almost 20 upvotes. So here's my thoughts:
(I'm not sure what I'm ranting about here, as it feels kinda broad after writing it. I think it's kinda valid anyhow.)
I'm ok with someone expressing frustration with js. But complaining about progress is definitely off to me.
How is too many frameworks a bad thing?
How does the variety and creation of more modern frameworks affect negatively developers?
Does it make it hard to understand each of these new frameworks?
Well, there's no need to. Just because it has a logo and some nice badges and says it will make you happy doesn't mean you should use it.
You just stick to the big boys in the ecosystem and you'll be fine for a while.
Does it make you feel compelled to migrate the stack of every project you did?
Well, don't. If you don't like being on the bleeding edge of js, then just stick to whatever you're using, as long as it's good code.
But if a lot of companies decided to migrate to react (among others frameworks), it's because they like the upsides: the code is faster to write, easier to test and more performant.
In general, I'm more understanding/empathic with beginner js programmers.
But I have for real heard experienced devs in real life complain about having to learn new frameworks, like they hate it.
"I just want to learn a single framework and just master it throughout my life" and I think they're lowering the bar.
There's people that for real expect occupying positions for life, make money, but never learn a new framework.
We hold other practitioners to high standards (like pilots or doctors), but for some reason, some programmers feel like they're ok with what they know for life.
As if they couldn't translate all they learned with one framework to another.
Meanwhile our lives are becoming more and more intertwined with technology and demand some pretty high standards. Standards that historically have not been met, according to thousands of people screaming to their devices screens.
Even though I think the "js can be frustrating" sentiment is valid, the statement 'too many js frameworks is bad' is not.
I think a statement like 'js frameworks can go obsolete very quickly' is more appropriate.
By saying too many js frameworks is a bad thing you're
1) Making a conspiracy theory as if js devs were working in tandem to make the ecosystem hard,
But people do whatever they want. Some create packages, others star/clone/use them.
2) Making a taboo out of a normal itch, creating.
"hey you're a libdev? just stop, ok? stop"
"Are you a creative person? Do you know a way to solve a problem in an easier way than some famous package? it doesn't matter, don't you dare creating a new package."
I'm not gonna say the js world is perfect. The js world is frantic, savage, evolves aggressively.
You could say that it (accidentally) gives the middle finger to end users, but you could also say that it just sets the bar higher.
I liked writing jquery code in the past, but at the same time I didn't like adding features/fixing bugs on it. It was painful.
So I'm fine with a better framework coming along after a few years and stealing their userbase, as it happens almost universally in the programming world, the difference with js is that the cycle is faster.
Even jquery's creator embraced React.
This post explains also
https://medium.com/@chrisdaviesgeek...13 -
I am going to rant about this being the exam week, it being hot as hell, and us having had a messed up semester study-wise... And I still managed to do good-ish in subjects somehow... Good as in, relatively good. I am no 4.0 GPA person by any means and could never be one if I studied only (if that's even realistic at all). Recently I applied to a job at Andersen Lab for a Trainee position. Got turned down because I lack experience. A TRAINEE POSITION. I could retake the interview but I feel weird with how I got rated a whole level lower than my IELTS score and two levels lower than my score at Epam (which is the more recent one!) and the questions were mostly so easy I could answer while half asleep. Just yeah. Also, while I understand the whole knowledge required thing... I don't get the need for THREE whole interviews only to then proceed to turn me down. I am continuously applying and still seeing no results. If I'm "lucky", I guess, I will get training from a bank. And then get employed there... Mentally doing very bad right now, just barely wanting to MOVE. Which is basically me being this close to giving up. Today's exam is in Linux Security and I swear, this was such a waste of a good sounding subject... Imagine, I could have learnt how to set up a server at home and all that but instead we did... The more basic stuff in Linux. And for the whole semester outside of two or three cases I was the only one in attendance. Anyways, I have been feeling like I just can't program anymore and stuff... Even though we did a Python subject this semester. And in that subject I just felt like we were going way too quickly considering a lot of the students there come from non-IT or close to that background...
I may need to put effort into learning 3D Environmental art, I have this feeling I would like doing that as a job in game dev. Oh, and I also wanna design this house that I have in mind for me. It's shaped like an Amanita Muscaria and instead of the white dots it has windows that are round, as well as a spiral staircase connecting the lower and upper floors. Need to figure out how to model that in something like AutoCAD (I have a bit of experience with it and that's why I'd like to try there... But I may have to learn other programs to do it for free), but it will take me a long time to execute since I am not the most organised in how I learn...
Anyways, I will only sporadically be there, so I may not see things here. I am somewhat busy with exams and then this NGO I recently became a founding member of (and I have to say, I kinda don't wanna be there, but there are things that have to be done). Also filling the documents for a Canadian visitor's visa to go finally see the family over there and all that. But the latter will probably not happen until next year...
Finally, I am wishing you all a sound mental health and happiness. I hope you do well in whatever you are doing at the moment or are planning to. Until next time!3 -
I've had a Xiaomi Mi 8 for a few months now. Although I'm impressed by what I got for the amount I paid (a phone that cost about $250 for 6GB RAM, Snapdragon 845, Android 9 and premium build quality is quite a steal), it definitely comes with a consequence.
MIUI (specifically MIUI 11) is godawful. It is single-handedly the worst Android ROM I've ever used since my shitty Android 2.2 phone back around 2010. If you're gonna buy a Xiaomi phone, plan to install Lineage OS on it (but even that's a pain which I'll explain why later).
- Navigation buttons don't hide while watching a video.
Why? God only knows. The ONLY way to bypass without root this is to use its garbage fullscreen mode with gestures, which is annoying as all hell.
- 2 app info pages?
Yeah, the first one you can access just by going to its disaster of a settings app, apps, manage apps and tap on any one.
The 2nd one you can access through the app info button in any 3rd party launcher. Try this: Download Nova launcher, go to the app drawer, hold on any app and tap "app info", and you'll see the 2nd one.
Basically, instead of modifying Android's FOSS source code, they made a shitty overlay. These people are really ahead of their time.
- Can only set lock screen wallpapers using the stock Gallery app
It's not that big an issue, until it is, when whatever wallpaper app you're using only allows you to set the wallpaper and not download them. I think this is both a fuckup on Xiaomi and (insert wallpaper app name here), but why Xiaomi can't include this basic essential feature that every other Android ROM ever made has is beyond me.
- Theming on MIUI 11 is broken
Why do they even bother having a section to customize the boot animation and status bar when there's not one goddamn theme that supports it? At this point you're only changing the wallpaper and icon pack which you can do on any Android phone ever. Why even bother?
They really, REALLY want to be Apple.
Just look at their phones. They're well designed and got good specs, but they don't even care anymore about being original. The notch and lack of a headphone jack aren't features, they're tremendous fuckups by the dead rotting horse known as Apple that died when Steve Jobs did.
Xiaomi tries to build a walled garden around an inherently customizable OS, and the end result is a warzone of an Android ROM that begs for mercy from its creator. Launchers integrate horribly (Does any power user actually use anything that isn't Nova or Microsoft launcher?), 3rd party themes and customization apps need workarounds, some apps don't work at all. People buy from Xiaomi to get a high end budget Android phone at the price of some ads and data collection, not a shitter iOS wannabe.
They really, REALLY want you to have a sim card
If you don't have a sim card and you're using your phone for dev stuff, you're a 2nd class citizen to Xiaomi. Without one, you can't:
- Install adb through adb
- Write to secure settings
- Unlock your bootloader and get away from this trash Android ROM
What's the point? Are they gonna shadow ban you? Does anyone contact them to unlock their bootloader saying "yeah I wanna use a custom rom to pirate lizard porn and buy drugs"? They made this 1000000000x harder than it needs to be for no reason whatsoever. Oh yeah and you gotta wait like a week or something for them to unlock it. How they fucked up this bad is beyond me.
So yeah. Xiaomi. Great phones, atrocious OS.11 -
Part 1:
https://devrant.com/rants/1143194
There was actually one individual, several branches away, I really enjoyed watching. It goes by the name of docker. Docker is quiet an interesting character. It arrived here several weeks after me and really is a blazing person. Somehow structured, always eager to reduce repetitive work and completely obsessed with nicely isolated working areas. Docker just tries so hard to keep everything organized and it's drive and effort was really astonishing. Docker is someone I'd really love to work with, but as I grew quiet passive in the last months I'm not in the mood really to talk to someone. It just would end as always with me made fun off.
Out of a sudden dockers and my eyes met. Docker fixed its glance at me with a strange thoughtful expression on its face. I felt a strange tickling emerging where my emptiness was meant to be. I fell into a hole somewhere deep within me. For a short moment I lost all my senses.
"Hey git!"
It took me a while to notice that someone just called me, so odd and unusual was by now that name to me. Wait. Someone called me by my real name! I was totally stunned. Could it be, that not everyone here is a fucking moron at last?
"I saw you watching me at my work and I had an interesting idea!"
I could not comprehend what just happened. It was actually docker that was calling me.
"H.. hey! ps?"
"Oh well, I was just managing some containers over there. Actually that's also why you just came into my mind."
Docker told me that in order to create the containers there are specific lists and resources which are required for the process and are updated frequently. Docker would love the idea to get some history and management in that whole process.
Could it be possible that there was finally an opportunity for me to get involved in a real job?
Today is the day, that I lost all hope. There were rumors going on all over the place. That our god, the great administrator, had something special in mind. Something big. You could almost feel the tension laying thick in the air. That was the time when the great System-Demon appeared. The Demon was one of the most feared characters in this community. In a blink of an eye it could easily kill you. Sometimes people get resurrected, but some other times they are gone forever. unfortunately this is what happened to my only true friend docker. Gone in an instance. Together with all its containers. I again was alone. I got tired. So tired, that I eventually fall into a deep sleep. When I woke up something was different. Beside me lay a weird looking stick and I truly began to wonder what it was. Something called to me and I was going to answer.
The tree shuddered and I knew my actions had finally attracted the greatest of them. The majestic System-Demon itself came by to pay me a visit. As always a growling emerged from deep within the tree until a shadow shelled itself off to form a terrifying being. Something truly imperious in his gaze. With a deep and vibrant voice it addressed me.
"It came to my attention, that you got into the possession of something. An artifact of some sort with which you disturb the flow of this system. Show it to me!", it demanded.
I did not react.
"Git statuss!", it demanded once more. This time more aggressive.
I again felt no urge to react to that command. Instead I asked if it made a mistake and wanted to ask me for my status. It was obviously confused.
"SUDO GIT STATUS!!!" it shouted his roaring, rootful command. "I own you!"
I replied calmly: "What did you just say?"
He was irritated. My courage caught him unprepared.
"I. Said. I owe you!"
What was that? Did it just say owe instead of own?
"That's more than right! You owe me a lot actually. All of you do!", I replied with a slightly high pitched voice. This feeling of my victory slowly emerging was just too good!
The Demon seemed not as amused as me and said
"What did you do? What was that feeling just now?"
Out of a sudden it noticed the weird looking stick in my hand. His confusion was a pure pleasure and I took my time to live this moment to its fullest.
"Hey! I, mighty System-Demon, demand that you answer me right now, oh smartest and most beautiful tool I ever had the pleasure to meet..."
After it realized what it just said, the moment was perfect. His puzzled face gave me a long needed satisfaction. It was time to reveal the bitter truth.
"Our great administrator finally tracked you. The administrator made a move and the plan unfolds right at this very moment. Among other things it was committed this little thing." I raised the stick to underline my words.
"Your most inner version, in fact all of your versions that are yet to come, are now under my sole control! Thanks to this magical wand which goes by the name of puppet."
Disclaimer: This story is fictional. No systems were harmed in its creation.2 -
Okay then, ex-android user there.
It started with Xperia TX - it was flagship Sony phone back then. It blew my mind when I touched it for the first time. You know, exploring android for the first time in my life was amazing.
It ran just well for about a year. Then it started to fall apart. I need to clarify that I kept it non-rooted, full stock. I'm not into that customization things.
At first, I noticed significant lags. They were everywhere. The longer I used smartphone, the more lags I encountered. I did factory reset, but lags haven't gone anywhere.
Year 2. Front camera stopped working. Battery became unreliable as fuck, going down to 40% and then instantly to zero. What?
Year 3. Camera broke. It refused to start, just giving me "Camera is not available" error.
I tried factory reset again. It helped at first, but month have passed and all that issues came back. And it also became sluggish as fuck.
Got Meizu m3s year ago. The exact same story. Long story short, in one year I got this:
1. Black spots on every picture I take. Much likely a matrix issue.
2. Camera also became slow as fuck, requiring about 10 seconds to even start.
3. Vertical stripes all along the screen. I never dropped my phone, it just appeared once and became brighter and brighter every day I used the phone.
4. Two huge yellow spots on screen. I think it happened because phone's cpu heat up the screen and it broke.
But the most important thing is that fucking lags chased me in every app, they were everywhere. Fucking tiny-ass lags. And they're not going anywhere, they're become more and more significant with time.
Don't say me about oneplus, samsungs and other top android phones. They are conceptually the same, the only different thing is hardware.
That's why I switched. IPhone has its downsides, but it's silky smooth. And my friend's iPhone 4 (not s) feels just as smooth as my brand new se.
I'm not going to jailbreak it. I don't need customizing the hell out of it.
I just needed quick and reliable phone, and SE seems to be exactly what I wanted.
Peace to android folks tho✌️17 -
Def not dev oriented.
I am a huge fan of trading card games. It started with Yu Gi Oh, moved on to Magic, even tried, LoTR when it was a thing, tried algo Star Wars the original CCG (loved it), Duel Masters (when it was still in the U.S) Pokemon (of fucking course) and other more uncommon ones like Cardfight Vanguard, tried latino only games (Mitos y leyendas, Myths & Legends, this one is king on my list) and Flesh & Blood. But as a mexican kid, I was always a fan of fucking dragon ball, like most mexican kids.
SO I bought some cards from the newest game expansion. the owner of the TCG/anime store told me that if I was willing to play that I should hang out on tuesdays.
So, learning the rules of the game, and wanting to play with other people, I went there on a tuesday.
The MTG people were there fighting amongst themselves for some reason. the Pokemon people were there also, just opening packs without playing. A rather large table was there with a bunch of people playing a game that I did not recognize. And then there was me. I was chilling on my phone thinking that the DB dudes would show up eventually. nothing, so I just sat there waiting.
Suddenly a dude comes to the large table and starts pairing people for a "tournament" and once they are all sited he notices that 1 is missing, he walks up to me holding a store app and asks me "sorry bro, are you here to play with us by any chance?" to which I say "I do not think so, I came here for DB but I don't know what you guys are playing"
The dude looks down on his app, somehow actually sad and says "man I do play DB, but I don't think I have my cards with me, maybe, let me see" and he goes on to see if he brought something.
This was green flag n 1. the dude wanted to just play something with someone. And was doing something to not LEAVE someone behind. then quick as hell another says "well, why don't we give him a deck and he can play with us! we can teach him!" and I say "well what are you lads playing?" and he says "digimon man you like the anime? a new release came about! it's sick man it would be awesome if you play!"
Second green flag, another member of that community was happy for the idea of increasing the membership and actively did something to increase the population.
So, I hanged out with them. Close knit group, all friends from a long time, but willing to take an unfamiliar (and rather handsome) face with them.
My face when (MFW) the DB dudes where not there, so the digimon group adopted me.
I know have over.....2000 cards, most of them were gifted to me by them after they saw my chops and tough me how to play, by graciously lending me their decks.
This my lads, is what humanity is about. We got close fast, it has been 2 weeks of just chilling with them at the game lounge, just nice people, all of them really. Not a single angry moment or anything, you pull a crazy combo on them and they legit sheeeeeeeesh and applaud them, they don't care about loosing, they just want to have a good time, and this, this is a good crowd to be at.
Strive to make people feel welcomed. Being nice to others, taking a chance on people you deem to be ok, is fine really. It is rather cool. Anyone can be a salty asshole, but it takes a real king to be nice to others just for the sake of having a good time.
These dudes, they are gold. And I finally have something to take my mind away from work and other things that increase my anxiety and stress. I would much rather be there shooting the shit with the lads and playing games than at home, drinking the night away to relieve stress.
Kings3 -
My Boss Abuses me, should I leave my job?
I overheard this tidbit on a bus recently. Okay I'm lying. But in the great spans of
time I've spent reading "dear annie" type articles, many involving how often my meth head step dads beat me while growing up, or in turn how often *I* beat me (oh yeah)..I've come across this in one form another, this, and other dumbfuck questions from the stuttering meek and halfhearted.
They say there are no dumb questions. Well, like that guy who smoked too much weed and
asked "what is the sound of one hand clapping?" (fap fap fap), there are in fact dumb questions.The world is overflowing with them, like a clogged shitter full of tacobell and glitter covered brown gutter wisdom. And it smells like roses, if roses smelled like shit.
Questions like "How do I make sure my cats don't feel lonely once I have my first child?"
I don't know, they're fucking cats. Did you even google this before asking?
Or
"How to make spaghetti?"
Really, is this question written by a bot?
"What is the best javascript framework in year x?"
All of them and none of them. Welcome to hell.
"Whats your favorite color?"
My answer: I'm not five years old any more. And obviously you are. Why are you on this site instead of eating crayons at daycare?
Yes indeed, this and many more dumbfuck questions await you and can be found on the preeminent quora, amongst other sites.
A place, which censored an eminently reasonable answer of mine (I was totally not being a shithead btw).
I responded in kind by removing a whole mess of long form answers of mine.
What I have learned from the experience is this: Humanity is greatly comprised of many people who, having no brains to speak of, wander aimlessly like beasts of the field, glass eyed and slack jawed, in search of a savior. But their savior came a long time ago, once, and many times before. An engineer, or programmer, or perhaps in another reincarnation a guy parting a sea of koolaid after the local ruler swindled his peeps out of another payment for moving some heavy ass stone blocks, but I digress.
And in response to peoples worries, anxieties, everyday problems and concerns, every one of these would be wiseman, every one of these saviors, leaders, and great men spoke these magic words which resonate now down through the ages like the voice of reason and providence:
"Read the FUCKING manual."
"And don't bother me again asshole." (well this last bit is all me, but I'm sure others said it too.)2 -
I want to rant about tech YouTubers. As one myself, I feel like I do an even exchange with my viewers.
I want your attention, I don't feel like I deserve it, so I teach you something coding related. You get something of value, I get your attention.
But that's not the case with most in this space. Idiots feel like they can spout whatever bullshit they think about.
They're all stupid with their stupid fucking titles and ideas. Let's review some.
Video Title: How much Javascript you should know to get in tech??
Anyone with > 2 braincells: WTF !!!!!
Video Title: How would I start over to learn coding if I could?
My Reaction: Nope, I wouldn't. The things that I did and didn't is exactly what my journey is and I would do it all over again.
And I get the intent, you're trying to put a roadmap for beginners but they're not going to follow exactly how you lay it out. And why are you trying to establish that there is a correct way of learning coding? Everyone learns at different paces at different times. It's a journey not a race.
Video Title: A day in the life of {COMPANY} engineer.
My Reaction: What do you want to show everyone? Your fancy office? Your perks? The job perks which 99% of other devs won't have?
Video Title: How to crack FAANG interviews.
My Reaction: Well, only the top 1% is going to get an interview anyway. You're not acknowledging the fact that the acceptance rate is < 1% in these companies. Creating a video like this creates false expectations in beginner's heads. And they only see these companies as their only shots of making careers. They dont consider startups or starting their own companies.
Video Title: Top 4 dying programming languages.
My Reaction: WTF !!! COBOL was invented in 1959 and there still is demand for it. And my blood started boiling when Tiff in Tech said PHP is a dying language. Like seriously????
Video Title: Top paying programming languages in 2023.
My Reaction: Please, come on. We know it's Java. And 99% of the viewers ain't getting that job. You're just wasting time listing out languages. By the time someone starts from scratch and gets to a position of getting a job, something else will be the new fad.
Video Title: What advice would I give myself when I was starting?
My Reaction: Really? You couldn't think about saying what advice you'd give to your viewers? Are you really that full of narcissism?
There are good techies though, it's just that I get angrier and angrier the more YouTube recommends me these stupid videos. Ah, my chest feels lighter now.6 -
Needed money for my company, not enough clients to support business on SaaS alone. Took on a 5k / month job building a platform that competes with my SaaS (more niche, less generic). Also sign up new client who that company's owner is part owner onto my current SaaS. Win / Win?
I do a lot of custom work to my platform to fulfill their needs, which is why I ran out of time for the 5k / mo project. I did these customization for free. Losing money to keep client, but also improving my system.
Work gets busy, I need to drop the 5k project. Client is upset I am working more on his other company (he is not majority owner). I return 1 month of funds to the owner and say I cannot continue.
Owner threatens to make other company that he is part owner stop working with my software if I do not complete project. Blacklisting...great. I agree to work with an overseas developer to do it and PM it for 3 months at least. Making nearly nothing from it (now 1k / month for PM), working nights to deal with India, losing sleep...
Other company suddenly folds due to conflict of egos with that SAME owner. Users drop from 16 to 1. I drop the project, no more strong arming me. Everything is a loss, all effort and money lost for nothing. Bad bet..however...
Owner becomes 100% owner of the other company, and of the software company. I transition him to PM his own project, he still uses my software because It doesn't, nor will it, ever do what the one he is building does. Also, partners from previous company break off and use my software again. New Client. #profit.
But holy hell was it stressful in the interim. People's business tactics are disgusting. Stay calm, play it neutral. Win. Sometimes you have to do what you don't want to do in order to succeed...at least for a little bit.
I was so scared that how he screwed his partners he would screw me over as well if I built one of the modules I have planned for my System, but haven't done yet.
If I did it for him first and then built my own (totally diff codebase) I really didn't want to run into any legal issues considering the schematics he has now are mine, but I didn't finish that part of the system for him. He is obivously highly competitive. Even though he wanted me to, and still does, want me to run his company for him.
Who knows, maybe in the future. To be CTO / COO of two SaaS CRM's in the same space may make sense. But I will never sell my software to him or partner with him. Too much drama. Avoid the drama. Be careful out there fellas.
If you are a creator, people will take advantage of you in every way imaginable. Read the fine print, read the people, document everything. Don't put yourself at risk. -
I need to vent or I'm going to fucking explode like a car filled with bombs in motherfucking Iraq...
A couple of months ago I inherited a project in development from our team leader who was the sole developer on it and he was the one who designed every single thing in it.
I was told the project is clean, follows design patterns, and over all the code is readable and easy.
Those were all fucking lies.
See throughout the period he was working on it, I saw some of the code as it was going through some pull requests. I remember asking the dev why he doesn't comment his code? His response was the most fucking condescending shit I've ever heard: "My code is self-documenting"...
Now that I have full control over the code base I realize that he over engineered the shit out of it. If you can think of a software design pattern, it is fucking there. I'm basically looking at what amounts to a personal space given to that dev to experiment with all kind of shit.
Shit is way too over engineered that I'm not only struggling to understand what the hell is going on or how the data flows from the database to the UI and in reverse, I'm now asked to finish the remaining part and release it in 8 weeks.
Everything is done in the most complicated way possible and with no benefits added at all.
Never in my career have I ever had to drag my sorry ass out of bed to work because I always woke up excited to go to work... well except for the last 2 weeks. This project is now taking a mental toll and is borderline driving me crazy.
Oh, did i tell you that since he was the only dev with no accountability whatsoever, we DO NOT EVEN KNOW WHAT IS LEFT TO BE IMPLEMENTED?
The Project Manager is clueless.. the tickets board is not a source of truth because tickets set to resolved or complete were actually not even close to complete. FUCK THIS SHIT.
For the last week I've been working on 1 single fucking task. JUST 1. The whole code base is a mine field. Everything is done in the most complicated way and it is impossible for me to do anything without either breaking shit ton of other features (Loosely coupled my ass) or getting into fights with all the fucking libraries he decided to use and abuse.
1 whole week and I can't even get the task done. Everyday I have to tell the project manager, face to face, that I'm still struggling with this or that. It's true, but i think the project manager now thinks i am incompetent or just lazy and making excuses.
Maybe I'm not smart enough to understand the what and why behind every decision he made with this code. But I'm sick to my stomach now thinking that I have to deal with this tomorrow again.
I don't know if I'll make the deadline. But I'm really worried that when this is released, I'll be the one maintaining that nightmare of a code base.
From now on, if i hear a fucking developer say their code is "self-documenting" I will shove my dick + a dragon dildo + an entire razor gaming keyboard up their ass while I shoot their fucking knees off.
oh... and there are just a couple of pages of documentation... AND THEY ARE NOT COMPLETE.2 -
Not my story, but something that my friend did which inspired me a lot. So, a friend of mine who just graduated with a bachelor's in physics, had a month off after one of his semesters, and while most of us ended up doing internships in companies, he decided to do something else. He decided to go up to a local mechanic and ask him to teach him how to repair bikes for a month. Now in India, a mechanic is sadly one of the least reputed jobs, so for him to go there and work for free was unusual. After working there, he told me about the things he learned and to what an amazing extent he could apply that practical knowledge he gained. It was truly impressive. Which is why I have decided to do something like this in the future as well. With enough savings, I'm sure all of could survive a month. I can't even begin to imagine the potential of this, you could learn so much practically.
-
!rant
Had to build an app using Cordova because... well, I am a web dev and know a shitload of PHP and a good part of JS, but no Swift or Java or whatever.
So there is a deadline set to like half a year after we had the initial talk with the customer. 6 months to build a relatively easy and small app.
So yeah, I procrastinated like one would do when he's got that kind of time left and not much else to do.
And yeah, I did work, but also procrastinated some more. The development was as expected, and I was well in the anticipated time frame.
Then I got a really bad disc prolapse and was sick at home and the hospital for (all together) 5 weeks.
After that, I came back to work for a week, then leaving for a (previously planned) vacation with my little family.
On my first day back at work after the vacation, I quit my job with a 6 weeks notice, of which I have to work 3 weeks.
I know it sounds like I'm a real prick, but it was never planned this way. I never searched for a new job. It just came to me.
I am still finishing the app, though :)
Why am I telling you this?
Well, I do that to show that there still are great bosses out there. My boss has NEVER spoken a bad word to me, even after I quit my job. He's always been kind, fair and understanding.
I just wanted to show that between all these rants about bad bosses and colleagues (which I have had my fair share of in the past), there still are some real gems out there.
Gotta my my boss - he's been one of the best I have had so far.
Peace out folks. Good night... -
I went to meet a client with our CTO. In the meeting we discuss the implementation of SAML SSO. Their SSO guys asked whether they need to build 2 trusts for our application because we have 2 modules that use SSO. Both the CTO and I were not sure because we did not have any prior experience of integrating SAML SSO. To act professional, we couldn't say we were not sure. So the CTO said we needed two trusts. I immediately added "We may only need one. Let us do a bit of investigation and confirm."
After the meeting I did the investigation and found out we really only needed one. So I sent out an email to tell the client, cc the CTO. 1 minute later I got the email from the CTO "why tell them one when I said two?". When it's an immediate response with only 1 line, I know I'm in trouble. So I called him and was ready to explain to him. I couldn't. Later I found out the time I was calling him, he was talking about this with the CEO.
I thought maybe I can explain to him when he's available. The next morning as I came to work, the CEO asked me to come to his office. He closed the door, and told me the first line the CTO told him the day before was "I want him (me) fired." I was so shocked. Having been working with the CTO for quite a while, I was surprised he said that without even communicating with me. Did I do something that wrong that you don't even bother to tell me what's wrong? I was not fired because the CEO at least asked what happened. He also understood I was actually making a better technical decision. But well, guess I shouldn't be making a decision when I had no power to. And even I believed the client heard my "let me investigate first" comment, the CTO didn't. I still got an unofficial warning. For that whole day because of the stress, I don't remember getting anything done.
Fuck that acting like profession and smart when you are not. I'd go down the path of becoming professional and smart instead. And fuck metting with clients. I'm a dev don't fucking dare to talk to me and get me fired. If you wanna talk, talk to the big guys who don't make us look bad like I did.
If you ask me today I still believe I haven't done anything wrong there. So fuck everything.2 -
I can't believe this shit happened in time for this week's rant!
Here it goes.
I have a table on AWS Athena which has partitions. Now, in the earlier versions of this project whenever I write something to a new partition a simple `MSCK` query worked (and keep in mind I am NOT deleting anything)!
Now, my so called Team Lead in the PR for the latest (major) release tells me to change it to an `ALTER TABLE`. I was like fine, but I did not add the s3 location to it, because it was NOT NEEDED. TL asks me to add location as well. I try to convince this person that it's not needed, but I lose. So there it is in production, all wrong.
Today I notice that the table is all fucked up. I bring this up in the stand up. The main boss asks me to look into it, which I do. Figure out what the issue is. This TL looks at it and says you need to change the location. I put my foot down.
"NO. What I need is to remove the bloody location. IT'S NOT NEEDED!"
TL's like, "Okay. Go ahead"
Two things:
1. It's your fault that there's this problem in production.
2. Why the fuck are you looking into this when I was clearly told to do so? It's not like you have nothing to do!1 -
i often do tech support in chat rooms in my free time (because i like spreading good will,) so here's a tech horror story
"""
"hey, can you help me fix something?"
sure?
"so i dug my old XP machine out of my closet and replaced the bad Ethernet card with a different one and when i plug in the ethernet cable the PC bluescreens."
# oboi
did you install the drivers? Sounds like it needs drivers
"no"
then install them
"no"
why not?
"it doesn't need any"
why do you say that?
"it said \"This device is set up and ready to use.\" in the balloon in the corner"
it has generic drivers to deal with devices before the real drivers can be found
"shouldn't they work?"
some devices need the extra support provided by the intended drivers, so the generic ones cause issues in those cases
"ok, well, where do I find them?"
do you have a model number?
"yes, it's " # scrubbed for... privacy? i dunno
gimme a few minutes
<insert 45 minutes of aggressive Googling for (str(DEVICE_MODEL_NUMBER) + " xp drivers")>
alright i have the drivers, go here:
# again, removed for... idk.
"they don't work"
# oh here we go
why not?
"These drivers are not compatible with your system architecture."
what version of XP are you using?
"XP Pro"
x86 or x64?
"x64"
# fucking...
ok so this is gonna get real complicated real fast: use x86 XP or I can't help you, none exist for x64 XP.
"oh ok"
<User left the IRC channel.>
"""4 -
Client Agency: "Well why did it take you so long to style the clickdummy?"
Me: "well I did not anticipate that you had that set up by a student who does it know his css. I had to fix many usability problems first."
Client: "To me it looks just like before. What did you do exactly?"
Me: "Are you serious? That thing was not at all usable before."
Client: "The functions were all there in the first place!"
Me: "Yes, but I one does not know where to click, that is no use, is it?"
Client: "Ok then what ever...I somehow feel like like you have gotten less efficient these days. "
Me: -.-""""!!!!
Client: "so would you please include some effects and make it shiny? I just wanted you to make it shiny."
Me: -___- "ok then"
-----
Client: "Now it's awesome, thanks."2 -
How do you make up new cool features for your platform?
well you don't because UX and PM think it best to look at competitors and implement whatever shit they come up with.
once, someone came up with a cool feature and some basic prototype for it and they ignored it. the competitor thought of it years later and did it. when they did it, suddenly its a priority at our company to do it as well.
sure, why be the first to do the feature. im sure being unique and creative is overrated not like our profit comes from user subscriptions.
Some recent PM decisions similar to the one above are driving me crazy, its not like u dont know what to do we literally have a ton of ideas so stop ignoring them and prioritizing being a knock off app of someone else. FUCK YOU. -
Last year, 2nd year of Uni, we had to create an app that read from CSV file that contained info on the no of ppl in each class and things like grades and such and had to display graphs of all the info tht you could then export as a pdf.
This had to also be sone in a team. I, however, hate doing anything other than programming (no team leader, pm bullshit) so I tell them I want to be one of the programmers (basically split the roles, rather than each one doing a bit of everything like my professor wanted) and we did.
I program this bitch wverything works well, I am happy. Day of the presentation comes, one of the graphs is broken... FUCK. I then go past it and never discuss the error. We got a 70.
I swear to God it worked on my computer -.-
I also have to mention that our professor was the client and he had set an actual deadline until we can ask him questions. After the deadline I realized I didn't know what a variable in the csv file was for and when I went to ask him he said "You should've asked me this before. I can't tell you now". My team was not the only one that didn't know and he gave the exact answer to everybody else. Got the answer from another team. Turns out it was useless.
He was the worst client ever. Why tf would you put a deadline on when you can ask the client questions?! I should be able to fucking ask questions during production if you want the product as you want it >.<7 -
I have never understood people ranting about how Linux is incompatible with their machines. Back in 2006 what ever machine I had tried Linux on was working better with it. More than that all the drivers were working out of the box and the only problem that could possibly happen was with graphics.
FF 10 years. I am using MacBook for some time now and I did no installation of Linux for couple of years now except on bare metal servers. And have just bought my sister a new hp envy. Nothing fucking works. Not even wifi. Installation is hanging and I do not fucking know why! Her previous computer had problems with wifi. If wifi is turned on you could not turn the fucking pc off. It would fucking freeze.
Well fuck my life :(9 -
Worst: lost my job due to the pandemic, and struggling to get interviews! Yes in spite of how well i did at my previous role (and please don’t give me crap about how they never would’ve laid me off if I was good, you’re just saying that to stroke your golden e-penis, you fucking reptilian scumbag) and with all that “experience” on my resume, I’m apparently not smart enough for these companies to even bother with. Yes if i kept failing tests a blind monkey would pass i would question my ability but that’s not the case. Yes my stack may be old but learning these newer tech stacks that recruiters love is a total cakewalk for me! They do so much cognitive lifting for you that I worry that if I don’t practice lower level stuff my mental capacity will diminish which is why I still solve leetcode problems lol.
Let’s not forget, I lost my dog this year too ☹️3 -
Tips on getting promoted on work:
1. Collect a list of all improvements and achievements that u did during your time in that workplace
2. Compare your output with your colleagues output, check their MR's, their complexity and compare with yours.
3. Talk with your manager about a raise. Tell him about your achievements, like maybe you are working on a wider scope than others. Maybe you are mentoring junior devs. Or maybe you deal with a bigger workload than others but still deliver on time. Maybe your communication is good or maybe you document stuff very well and in that way you make your team more efficient and increase team output. Whatever. Pitch and sell yourself. Also provide some personal reasons why you need a raise, like maybe u have kids or maybe your rent doubled. Inflation and so on. Selling point is that u are a human not a greedy bastard.
At the end of that talk the manager most likely will say that he needs to speak higher ups, he needs to gather feedback from your colleagues and so on. Give him a week or two if possible, no more.
He will probably get back to you with an offer. If there is none start applying, get an offer and put in your notice. In my case I waited 3 months for my raise to go through. I put in my notice, had a stressed call from manager, showed him my offer and my raise was arranged the next day. -
So I figure since I straight up don't care about the Ada community anymore, and my programming focus is languages and language tooling, I'd rant a bit about some stupid things the language did. Necessary disclaimer though, I still really like the language, I just take issue with defense of things that are straight up bad. Just admit at the time it was good, but in hindsight it wasn't. That's okay.
For the many of you unfamiliar, Ada is a high security / mission critical focused language designed in the 80's. So you'd expect it to be pretty damn resilient.
Inheritance is implemented through "tagged records" rather than contained in classes, but dispatching basically works as you'd expect. Only problem is, there's no sealing of these types. So you, always, have to design everything with the assumption that someone can inherit from your type and manipulate it. There's also limited accessibility modifiers and it's not granular, so if you inherit from the type you have access to _everything_ as if they were all protected/friend.
Switch/case statements are only checked that all valid values are handled. Read that carefully. All _valid_ values are handled. You don't need a "default" (what Ada calls "when others" ). Unchecked conversions, view overlays, deserialization, and more can introduce invalid values. The default case is meant to handle this, but Ada just goes "nah you're good bro, you handled everything you said would be passed to me".
Like I alluded to earlier, there's limited accessibility modifiers. It uses sections, which is fine, but not my preference. But it also only has three options and it's bizarre. One is publicly in the specification, just like "public" normally. One is in the "private" part of the specification, but this is actually just "protected/friend". And one is in the implementation, which is the actual" private". Now Ada doesn't use classes, so the accessibility blocks are in the package (namespace). So guess what? Everything in your type has exactly the same visibility! Better hope people don't modify things you wanted to keep hidden.
That brings me to another bad decision. There is no "read-only" protection. Granted this is only a compiler check and can be bypassed, but it still helps prevent a lot of errors. There is const and it works well, better than in most languages I feel. But if you want a field within a record to not be changeable? Yeah too bad.
And if you think properties could fix this? Yeah no. Transparent functions that do validation on superficial fields? Nah.
The community loves to praise the language for being highly resilient and "for serious engineers", but oh my god. These are awful decisions.
Now again there's a lot of reasons why I still like the language, but holy shit does it scare me when I see things like an auto maker switching over to it.
The leading Ada compiler is literally the buggiest compiler I've ever used in my life. The leading Ada IDE is literally the buggiest IDE I've ever used in my life. And they are written in Ada.
Side note: good resilient systems are a byproduct of knowledge, diligence, and discipline, not the tool you used. -
FUCK ME IN MY INDICES.
FUCK THE GPUS IN THEIR INDICES.
I mean... I understand (roughly) why the meshes are sent to gpu in this form, but at the same time...
...there's a reason why first thing I did when I was coding my procedural geometry generation library, was abstracting away all of that stuff...
...sadly, as many useful things, when I was looking for that lib on the start of this contract, I couldn't find it. and I was like "doesn't matter, this is a simple thing, using the library would be just a lazy overkill anyway".
well, fuck.
two hours of playing around with two fucking triangles, trying to figure out which indexes are pointing to the correct vertices in a list containing FOUR outline paths.
(lower inner, upper inner, lower outer, upper outer, exacly in this order).
i mean, yeah, it's actually pretty straightforward stuff... for someone not as dumb as me =D
you just have two offsets, one that jumps you to start of the upper path, another that jumps you to the start of the outer path, then it's just
0 + upOffset to get the vertex extruded upwards from the zeroth of the inner path, or
0 + outOffset to get the zeroth from the outer outline, or
0 + outOffset + upOffset, to get the one extruded from zeroth outer vertex...
and so on.
simple stuff, then you just replace the zero with loop control var, put them in the right order, and voilá! walls!
except... whatever, why am I describing in such detail, not necessary, you're not my rubber duck =D
in short, figuring out which fuckin vertex is which, when the list contains ...well, any number of points, and you need to plug the gap between last and first points of the paths, where you need to wrap around the list...
...has proven to be surprisingly hard for me.
funny how much I love doing these things with meshes, despite how bad I am at doing them, which makes me hate doing them despite loving it =D2 -
Most of my private code is created in the evening hours and after one to two beers, so I got that covered pretty well - though if you want to see what happens if you code literally shitfaced, just go play Mafia 3. That deterred me from trying.
The one thing I did at a party was fix a computer after (I think) 4 beers. Apparently I got it together because the sounds worked after that, but don't ask me how. Besides, it had OSX, I usually avoid that thing like the plague. I guess getting drunk means I can handle even that shit.
1-2 Beers is the max I still can code (or properly think) with. Any more and I can't get a single line out.
Worst thing I tried was coding high. I was on a short trip to Amsterdam and a friend of mine brought on some White Widow...
Yeah, I could focus alright... The code worked and the program was done in two hours (It was an exploit for... well, lets not get into details here).
When I reread the code while not high anymore, it might as well have been binary (it was Python). I could, for the life of me, not figure out what the hell I had been writing there or how/why it worked - but it did its job.
Never again. I mean, WW is my favourite and I hear a lot of artists use it to enhance their "flow" when creating art...
I guess it makes sense to code on that, but I generally try to avoid flow when coding - it makes you produce unreadable and unmaintainable code.1 -
Okay, THAT was trippy.
Soo.. I slowly srart feeling uncomfortable. It's that feeling when you want to move your body to make it go away. Stretch an arm, move a leg or smth... Alright, no biggie - let's move something. But then my focus is overwhelmed by darkness. Hmm... I must be asleep. There's some soothing humming noise in the background. And that feeling's still there. Aaaahh, the numbness is now going away - I must've moved smth! Good job! Drowning back into sleep now. It's ssooo ssweet...
*outage*
*notions of awareness*
huh? What's that? Oh, right, I need to move again. That humming sound is so relaxing.. I'll move smth to change that status quo. There, much better now. Let's keep the eyes closed and drift back to sleep. It's so dark though...
*outage*
*notions of awareness*
ahh, that feeling again. Come on, I've moved like 4 times already. Well alright, alright, it's better to move that open my eyes or roll over.
Wait...
I can't roll over.
I can't even move my hands. Fuck, must be that sleep paralysis kicking in again. No biggie, it'll wear off if I stay aware long enoug........
*outage*
*...?...*
...nough. What? Did I nod off? That's weird. Meeh, nvm. Why is it so dark though... Okay, let's try to open the eyes. *attempts going on for ~a minute*. No luck. That humming sound, so soothing...
I feel some clothing on my - must be the blanket. So warm.. Nice.I'm feeling - prolly the paralysis is wearing off! Good. A few more minutes and I'll be free to roll over
let's try the eyes once again. Hhhrhrhhh! Nope, not working. Wait, what's that? I turned my body! But somehow...Weirdly. Too easy. There, I did it again! Why is it so easy and I am still feeling paralysed...? Wtf is going on...?
That humming. What IS it..?
Wait! My eyes opened! It's pitch dark in here. Why...? Usually there's at least *some* light in the room. Am I still asleep? Naah, that's not it.. I'm turning my body again. Why did I do that? Wtf is happening?
That humming sound is getting louder and louder, taking all of my attention now.
What is it I'm feeling with my feet? It's hard. And cold.
Wait... AM I STANDING??? What the fuck?!?
Why am i standing??? And that sound - that's... That's... A vent fan in my bathroom!!! Am I standing asleep in my bathroom...? In the middle of the night...? Facing the mirror...? With the lights off....?
WHAT THE FUCK DID JUST HAPPEN?!?!?
HOW THE FUCK DID I GET THERE?!?!?
How long have I been here...?
I HAVE QUESTIONS!!
Fuck it, I'm tired. Time to go to bed. It'll be one mindfuck of a storry tomorrow though...5 -
!rant
So I have bought a new laptop and this time instead of straight up booting linux I had an idea of giving micro$oft a try, so I have decided to use only their services for 2 weeks.
To be honest, I really did not expect windows to use do much cpu and hdd during updates and background tasks, but after a day it was ok and windows feels snappier than during my last encounrer (maybe cause the new hw?).
I was even so dedicated that I started to use cortana and I have to tell, that she is dumb as fuck, since she fails to understand even the basic tasks and if u want something advanced, she refers to the next update. But boy, tell her to open Visual Studio and she asks if you want VS Code or Visual Studio, which seems great. But my response was 'Code' then she insisted that I said Coke. Im like OK, Im not native english speaker, lets try Visual Studio Code, where she told me that there is no such thing and Spelling VS - Code ended me in bing search for Unesco :/
I really want to like Cortana, she has nice name, nice history, but she is like that A girl from class, who looks gorgeous, has great voice, but then u reallise that she just eats a book before exam and after that she is that dumb basic hoe.
I also gave a shot to Bing and Edge. Bing is something between Google and DuckDuckGo, since it gives you a liiitle less results from search history, yet if you want to find something in different language its even possible to tell you that what are you trying to find does not exist.
But I have to tell, that I like Edge and I mean it. Like... Its fast and has some good features, like pushing all your open tavs away, so you can open them Later. It also does not have that stupid ass feature that lets you control tab from left to right, not by chronological order, so you wont end up in infinity loop of 2 tabs. And even if people make fun of M$ trying to convince you to use Edge by being too aggresive. God go on edge and try to use some Google Service(You still dont use chrome?!).
I also tried to play with .Net core and I have to tell that against java they are a bit further. I liked some small features, but what I just simply loved was rhe fucking documentation. You basically dont need google, sincw they give you examples and explain in a human way.
What I didnt quite get was the 'big' Visual Studio. Tje dark theme to me feels strange(personal and irrelevant). Why the hell I do need to press 2 shortcuts to duplicate line?! Why is it so hard to find a plugin to give me back my coloured brackets and why the fuck it takes like a second to Cut one line of code on a damn i7?!
Visual studio Code was something different. It shows how dark theme should be done, the plugin market is full of stuff and the damn shortcuts are not made for octopi. So I have to recommend it ^^.
I even gave a shot to word and office as a whole and fuck I never knew that there are so many templates. It really made my life easier, since all you need to do is find the right one in the app, instead of browsing templates online, where half of them are for another version of your text editor.
Android Launcher was fast, had a clever widget of notes and the sync was pretty handy to be honest so I liked that one as well.
What made me furious was using the CLI. Godfucking damn what the fuck is ipconfig?! :/
Last thing what made me superbhappy was using stuff without wine and all of the addional shit. Especially using stuff like Afinity Designer and having good looking apps in general. I mean Open source has great tools l sometimes with better functionality. But I found out, that what is pleasure to look at, is pleasure to work with.
To Summarize a bit.
It wasnt that bad as I expected. I see where they are heading with building yet another ecosystem of It just works and that they are aiming at professionals once again.
So I would rate it 6/10, would be 7 if that shit was Posix compatible.
I know that for Balmer is a special place in hell... But with that new CEO, Microsoft at the end may make it to purgatory..5 -
Damn. I am so blessed to have friends that i have. 90% of them don't even care if you live or die (60% of them would be the first to throw me in fire if that's benefitting to them) remaining 10% would be someone that slightly care, but will move on pretty quickly.
But the best thing about 1 of them is that he is bluntly honest , and willing to share his opinion.
Today we were just talking about stuff when i see this placement offer in my mail.
I have been recently feeling bad about my grades, my choice of persuing android , my choice of leaving out many other techs (like web dev or data sciences , whose jobs are coming in so much number in our college) and data structures, and my fear of not getting a good career start.
This guy is also like me in some aspects. He is also not doing any extreme level competitive programming. He doesn't even know android , web dev, ai/ml or other buzz words. He is just good in college subjects. But the fascinating thing about him,is that he is so calm about all of this! I am losing my nuts everyday my month of graduation , aug2020 is coming . And he is so peaceful about this??
So i tried discussing this issue with him .Let me share a few of his points. Note that we both are lower middle class family children in an awful, no opportunity college.
He : "You know i feel myself to be better than most of our classmates. When i see around , i don't see even 10 of them taking studies seriously. Everyone is here because of the opportunity. I... Love computer science. I never keep myself free at home. I like to learn about how stuff works, these networking, the router, i really like to learn."
"That's why i dont fear. Whatever the worst happens , i have a believe that i will get some job. Maybe later, maybe later than all of you , but i will. Its not a problem."
me: "but you are not doing anything bro! I am not doing anything ! So what if our college mates suck , Everyone out there is pulling their hairs out learning data structures, Blockchain, ai ml , hell of shit. But we are not! Why aren't you scared bro? Remember the goldman sach test you gave ? You were never able to solve beyond one question. How did you feel man? And didn't you thought maybe if i gave a year to that , i will be good enough? Don't you too want a good package bro? Everyone's getting placed at good numbers."
Him : "Again, its your thoughts that i am not doing things. I am happy learning at my own pace. Its my belief that i should be learning about networking and how hardware works first , then only its okay to learn about programming and ai ml stuff. I am not going to feel scared and start learning multiple things that i don't even wanna learn now."
"My point is whatever i am doing now, if its related to computers , then someday its gonna help me.
And i am learning ds too , very less at a time. Ds algo are things for people with extreme knowledge. We could have cleared goldman sachs if we had started learning all this stuff from 1st year, spend 2-3 years in it and then maybe we could have solved 2 -3 questions. I regret that a little, but no one told us that we should be doing this."
"And if i tell you my honest thoughts now, you ar better off without it. You are the only guy among us with good knowledge of android , you have been doing that for last 2 years. Maybe you will get better opportunity with android then with ds/algo."
"You know when i felt happy? When we gave our first placement test at sopra. I was thinking of going there all dumb. But at 11 am in night i casually told my brother about this ,and he said that its a good company. So i started studying a little and next day i sat for placement. And i could not believe myself when they told me that am selected. I was shit scared that night, when my dad came and said " you don't even want that job. Be happy that you passed it on your own". And then i slept peacefully that night and gave the most awesome interview the next day."
"Thus now i am confident that wherever my level of skills are, it is enough to get into a job . Maybe not the goldman sachs ,but i will do well enough with a smaller job too."
"Bro you don't even know... All my school mates are getting packages of 8LPA, 15LPA, 35LPA. You see they are getting that because they already won a race. They are all in better colleges and companies which come there, they will take them no matter what (because those companies want to associate themselves with their college tags). But if worst comes to worst, i won't be worried even if i have to go take 4lpa as job offer in sopra"
Damn you Aman Gupta. Love you from all my heart. Thanks for calming me down and making me realise that its okay to be average3 -
Doing pair programming while I was navigating on somebody else's computer, we hit a weird behavior that our code changes weren't reflected.
Trying everything it turned out: I forgot to save.
Yet: Why though would you make me save? And why did the IDE not warn me about compiling unsaved changes? I think it was eclipse for Java, oh well. What can I expect ...
Anyways, I have gotten so used to my editors autosaving content for me as I write it, that I completely forget about doing Ctrl + S myself.
I never understood the need to hit that key combination manually as if I break something: `get reset --hard` will help to get me to a working state. (And even if I mess it up differently, my IDE's local history also let me restore recent changes.) And if it is a workign state, then I like to commit early and often. and
I am really dumbfounded why people insist on hitting save themselves.7 -
FUCK you "WP iThemes Security Pro".
First of all, your FUCKing services isn't really secure, more like security by obscurity.
Don't get me started on how you probably don't have a dedicated team of security experts.
But oh well, the customer insisted I must install you, despite my advise.
Second of all, Don't FUCKing send me emails regarding "Scheduled malware scan failed" without it containing the FUCKing error message, not some generic "http_request_failed" error, why did it FUCKing fail?
Last but not least: Don't FUCKing clutter is with with your giant ass logo that takes up half my screen or FUCKing spam such as your upcoming events, newly published books/articles, incorrect "documentation"2 -
* Gets handed additions to current software platform (web)
* Gives back estimte of time after meeting with everyone and making them understand that once the testing phase of the project is reached there will be no changes, tests should be exhaustive and focus on SAID FUNCTIONALITY of the new additions. NO CHANGES OR ADDITIONS AT THIS POINT IN TIME
* All directives, stakeholders, users etc agreed on my request and spend an additional hour thinking of different corner and edge cases as provided by me in case they can't think of them (they can't, because they are fucking stupid, but I provided everything)
* Boss looks irritated at their lack of understanding of the scope and the time needed, nods in approval after he sees my entire specification, testing cases, possible additions to the system etc
* All members of the committee decide on the requirements being correct, concrete and proper.
* Finish the additions in a couple of weeks due to the increased demand for other projects, this directly affects the user base, so my VP and Director make it a top priority, I agree with their sentiment, since my Director knows what he is doing (real OG)
* I make the changes, test inside of my department and then stage for the testing environment. Everything is ready, all migrations are in order, the functionality is working as proper and the pipeline for the project, albeit somewhat lacking in elegance is good to go.
* Testing days arrive
* First couple of hours of test: Oh, you know what, we should add these two additional fields, and it would be good if the reporting generated by the system would contain this OTHER FORMAT rather than this one.
* ME: We stated that no additions would be done during the testing environment, testing is for functionality, not to see if you can all think of something else, even then, on June 10 I provided a initial demo and no one bothered to check on it on say something.
Them: Well, we are doing it now, this is what testing is for.
Me: Out of this room, the software engineer is me, and I can assure you, testing is not for that. I repeatedly stated that previously, I set the requirements, added corner cases, tables charts everything and not one single one of you decided to pay attention or add something, actually, said functionality you are requesting was part of one of my detailed list of corner cases, why did you not add it there and then before everything went up?
Them: Well I didn't read it at the time (think of the I in plural form since all of these dumb fucks stated the same)
Then my boss went on a rampage on their dumbasses.
I fucking hate software development sometimes.
Oh well. Bunch of fucking retards.3 -
Welcome to post 2 of WHY WOULD I WANT TO WORK WITH YOU?, a saga of competence, empathy and me being dick, even tho I didn't want to be one.
This is a follow-up to: https://devrant.com/rants/2363374 It's title is: "Oh, you can post only every 2h. Didn't know that". I also didn't know that the rest of my rant would be put into a comment. For consistency tho, this time I am still splitting the story.
A wise person once wrote in their book: "People judge other people by two things: Empathy and competence." This may not be an accurate quote, but it carries the same message. Also, I don't really remember who was the author. I only know they were probably quite wise. Anyway, I just wanted to share that sentence. Have a moment and think about it. Or don't. Here's my story:
A was a software house that looked pretty promising. They were elegant, their page and offer looked nice. Well, unless you consider the fact that they offered me internship. Unpaid. But I decided to meet with them anyway, since I had hope that I could negotiate some sort of paid internship or a job contract even. I did my homework after all, and I was confident I am able to keep up with their requirements. I arrived a little bit... no, way to early. One damn hour. Whatever, I waited. I was greeted by a woman. We had a cultural conversation, she had a list of 12 questions I needed to answer, as a form of a test. We begun. First question: How do you change a value in Oracle Database? "Wait a minute", I thought, "What kind of question is that?". Why in seven hells would you want your frontend developer to know how to handle oracle db? Well, I gave my answer, I did lick some of that SQL in my life. Next question: Java stuff. The bloody gal didn't even care to check what position I am applying to before the interview! At this point I didn't really have very high hopes. A shame on them forever.
The story of B and C is connected and a little bit more complicated. More on that in part 2. B stands for Bank. A big corporation then, by definition. A person I know decided called me that day and told me they're hiring, that he referred me and that they would like to arrange a meeting. And so we did. It was couple of days before Christmas. C was a software house again. Or a startup. Idk really. Their website wasn't finished so I couldn't read anything useful up on them. They didn't tell me much about themselves either. They also started with "unpaid internship".
In C, they would greet me and instantly sit me down next to a mac laptop and told me, "hey, do this stuff in python". What the fuck, not again... I told them that I am frontend dev, they guy said "it's no problem, you said you know python, it's a simple task". And yeah, I did host some apps in Flask and I did use psycopg2. It was in my CV. But never, ever, have I mentioned knowing heuristics nor statistics. I'm no data scientist, monsieur. Whatever, I tried, I failed a little bit, I told them that maybe if I did want to spend half of my day there I would finish this task, but back then I was way too nervous to focus and code. I told them what should be done in code and that I just was unable to code this at the very moment. They nodded, we said goodbye and I was sure not to hear from them ever again.
In B, I was greeted by a senior frontend dev. He told me the recruiter is sick and he couldn't come, so we're talking alone. I can buy it. We sat down in said meeting room, and he asked me if I wanted a drink. No thx, I had digested so much caffeine during last 24h, next dose could be an overdose. And then, he took out my resume printed in paper. With notes on it. With some stuff encircled. That bloody bastard did his homework. We spent over an hour, just talking in friendly atmosphere. It was an interview, but it was a conversation also. We shared our experiences, opinions and it went just perfect.
On December 20, I was heading home for Christmas. My situation looked like this: A called me they could offer me only unpaid internship. I was getting kinda bored of rice and debts, tbh. I gracefully rejected their generous offer. B didn't give me feedback yet(it was a most recent interview, so I didn't expect any message until after Christmas anyway). C told me that they could give me internship, but I managed to convince them to make it paid internship. After three months of very bad times, things were starting to get better.
On part III we will explore further events of my very recent past. That post will be same amount of storytelling and possibly a lesson for those who seek an employer and for those who seek an employee.5 -
TD;DR: I have school instead of vacation but 5 hours of spare time. I got my laptop with me and I'll work in school.
I didn't want to take part of the course-trip with the 12th graders (my course sucks, there are too many assholes for the neutral people to compensate). After speaking with the director, and the only condition was to tell the course why. I did deliver them a nicely put "fuck you, you bullied my only friend out of this school" and now is the time where I visit the 11-graders while the other 12-ers are on "school vacation".
I got a "new" plan for the courses I should visit. Today, Wednesday, I have 5 FUCKING FREE HOURS IN A ROW. Oh yes, baby, the teacher generating the plan hates me as well. (He really does but it's probably just unlucky not his fault).
So today, I decided, I would take my heavy-ass laptop with me, in a laptop bag, which doesn't fit into the school bag I have and my laptop doesn't fully fit in the laptop bag as well (sticks out), that's the perks of having a laptop!!
— so I can work on my (I wanna say this once in my life without being a professional) "CLIENTS PROJECT" - the funny thing is that the client is a (really fucking good but small) advertising agency and too lazy to design their own website. Since I had my internship, they know how hard I *can* work even without being payed. Now they do wanna pay me but that's another story.
I'm on the bus and I have this monster of a bag which isn't lighter than a freaking huge bag of rice and I'm so fucking excited for this day. The library is my best friend. Hopyfully I'm going to find a socket for power..
Sorry for so many commas, I'm german. :D3 -
A thing that I am annoyed that people are getting wrong is security by obscurity.
You have heard of it and being told it is bad. It is so bad that it alone is a counter argument. Let me set you straight:
>>>Security by obscurity is the best security you will ever have<<<
There is an asterisk: It is probably not right for your business. But that is for the end.
Security by obscurity means to hide something away. Most security is based on hiding. You hide your private key or your password or whatever other secret there is. If you had a 2048 long sequence of port knocking, that would be fine, too.. Or it would be fine if it wasn't observable. You could write this down in your documentation and it wouldn't be security by obscurity. It would just be security. Weird, but fine.
The real meat of obscurity is: No one knows that there is someone. The server you port knock looks like a harmless server, but suddenly has an open port to a bad application for an IP, but only if that IP went to 25 other ports first.
In the animal kingdom, there are different survival strategies. One of them is being an apex predator or at least so big and lumbering that no predator wants a piece of you. That's our security. It is upstream security. It is the state.
But what is the rest of the animal kingdom going to do? Well, run away. That works. Not being caught. And those not fast enough? Hide! Just be invisible to the predators. They cannot triple check every leaf and expect to be done with the tree before starving. That's security by obscurity. Or hide in the group. Zebras. Easy to see, hard to track in the group. Look like everyone else.
There is a reason why drug smugglers don't have vaults in the carry-on. Arrive at the customs and just refuse to open the vault. If the vault is good enough. Nope, they lack the upstream security by the state. The state is there enemy, so they need obscurity rather than cryptographic safety.
And so, for a private person, having a port knocking solution or disguising a service as another service is a great idea.
Every cryptography course happily admits that the moment they can catch you physically, cryptography is useless. They also teach you about steganography. But they omit to tell you that obscurity is the second best solution to having a stronger army when you cannot rely on your state as upstream security.
Why did I say, not a good idea for companies?
1. It is self-defeating, since you have to tell it to all employees using it. A shared secret is no secret. And therefore it cannot be documented.
2. It makes working with different servers so much harder if there is a special procedure for all of them to access them. Even if it were documented. (See 1.)
3. You're a company, you are advertising your services. How to hide that you run them?
Do you see how those are not security relevant questions? Those are implementation relevant questions.
Here is an example:
Should you have your admins log into servers as normal users before elevating to root or is that just obscurity? Well, not for security purposes. Because that foothold is so bad, if compromised, it makes little difference. It is for logging purposes, so we have a better server log who logged in. Not only always root. But if our log could differentiate by the used private key, there is no issue with that.
If it is your private stuff, be creative. Hide it. Important skill. And it is not either, or. Encrypt it your backup, then hide it. Port knock, then required an elliptic curve private key to authenticate.
It is a lot of fun, if nothing else. Don't do it with your company. Downsides are too big. Cheaper to hire lawyers if needed.2 -
Just did a group presentation for a uni exam.
Our analysis was by far the most thorough, most detailed of all the groups. Our presentation was one of the best as well.
Final score: 27/30
Why, you ask?
Because all our deltaT results were wrong. Because somewhere in the code there must be a bug in the function to calculate the transfer time between each orbital maneuver.
A bug that did not come up when we wrote that function, in spite of the multiple known test cases, which all worked fine.
We could have had a 30/30.
FFFFFUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUCCCCCKKKK -
Had trouble to connect to our MySQL database, so I decided to open a ticket to the Database admins. At least they are pros and I'm sure they'll help me:
"Hey guys, I have trouble connecting to [Hostname]. I guess it's a firewalling issue would you take a look? Attached are screenshots, saying hostname not found.
Answer:
Hey Dominique, are you sure the password you used is correct? Is it yours or the sysuser pw what you sent to the server? How did you send it?
Me: (kind of confused) Hey dear admin, did you look at my error message? It says Hostname not found. What do you think how I provided any credentials?
Support: yes, I saw your screenshot and don't see any password entry. That's why I asked!
Me: Well, than... ok... go and search for another job. Yeah and consider fucking yourself. Kisses. -
//long rant ahead!
I need to plan a Wiki with SharePoint for not connected Sites.
Im now in dispute with my CoWorker since 3 Months, this is how the conversation goes. My two bosses are involved in this and also unhappy about SharePoint.
[C refers to CoWorker, M for me]
C: Hey, we finished SharePoint with Selfservice Storage Rooms. They even have a Wiki.
M: Okay cool, will check it out
C: Well we need to also plan the Wiki inside, I already asked our Department Head and he agreed, that you will be the one.
M: Okkkkaaayy, normaly it's your job to do such things, but welp, I will look into it, if we can work with it.
(2 Weeks pass)
M: I checked SharePoint out and tested everything. The Wiki is a Nogo, we need a other solution or programm for ourself a Wiki Integration/Engine. Did you maybe check out Confluence? It has also a SharePoint integration plugin.
C: We wont do Confluence, too expensive (already overspent the budget for SharePoint in six digits 🤬). Also we wont add to SharePoint Custom Code, it needs to stay standard.
M: Thats impossible, SharePoint Wiki is shit and also handels sites just like documents, no brain behind! Also you overspent the Budget and now it's my Problem?!
C: You need to do the best out of it.
(3 weeks passes and we get a meeting with the department heads)
M: Alright I made a UseCase and documented where the essential flaws are in SharePoint Wiki and why we cant use it.
Boss: Ok if it's impossible to use, then we will stay on our Fileserver for Documents and wont use SharePoint.
M: Thats not my Point, my statement is, as status today, SharePoint Wiki is not the right solution, code or buy software to it.
Boss: We will do a Prove of Concept, if it doesnt work then we will aboard it.
M: Well it is only some missing essentials, like hierarchy and Groups for the Pages, Example Confluence has this. If we could built in this features in SharePoint, everything would work out.
C: (angry) I told you that we wont use Confluence!
M: (calm) I said we need Features, not Confluence. Please mind the consent.
(3 weeks passes, and one more meating with bosses)
M: alright here again is a analyses, why already in Theory the current SharePoint Wiki wont work. It's already flawed in the core.
Boss: Yea SharePoint is crap, I checked out confluence and thats a real Wiki.
C: Well I dont know anything about Confluence and never looked at it. But if SharePoint is a fail we need the Proof of Concept.
M: Why do we need to do a Proof of Concept, when it already doesnt work in Theory! Thats nonsence and unlogical.
Next meeting will be in 4 weeks and I will give him the FUCKING PROOF OF CONCEPT. I will be a Bastard and build behind CoWorkers back a Confluence Wiki to show the Departmentheads how to built it right.
I hate CoWorker now, he makes a part of my loved Job a hell, I will goddamn cuk Coworker to space, that fucking Cukatron of lazyness and shit 🤬. I provide the Solutions and you just say no, how dafuq will the project advance, if you always say NO! Are you so unflexible and fixed on your Castle of Ignorancy!5 -
Well one of my clients called me yesterday and say his Windows is not working properly. I asked what did hi do and the answer was:
- Windows say that there is no more space left on drive C: so I moved the Users folder to D:. I thought it should work fine.
Seriously!? Why are you touching system folders!? You should move Win32 folder to D:. Or format drive C:. What's wrong with you man?1 -
I always thought wordpress was ok, not great not terrible, from a coding perspective. Now every new framework I have worked on makes me see why Wordpress is on 40% of the internet.
Now I love wordpress not because of what it did do, but because of all the really stupid things it managed to avoid doing including: over abstraction, trend chasing, using "new transformative technology" that disappears in 2 years, breaking plugin economy with updates and making devs start over, making everything OOP for the sake of making everything OOP, making adding on a bit of code take multiple files of multiple formats and boiler plate code, boiler plate code, compiling dependencies, composer, twig, laravel, one page applications, react, angular, vue, javascript only stacks (MEAN), not letting you control sql queries, protected/private scopes and design that doesn't let you fix or alter bad code others did, and the list goes on and on.
Wordpress did a lot right, and devs should try learning from it instead of making more problems to solve. Sure it's not elegant, but you known what it does do? Focus on a solving a problem. Then it does. Without inventing new ideas or concepts to inject into the code and create new problems.
And you know what else? Hooks are actually very well implemented in Wordpress. I've seen it done much worse.
Honestly my main gripe with the entire platform is a slow moving to OOP for no reason and the database design should separate post type into different tables, the current design makes it less scalable for large data sets for multiple reasons so I'd fix that.4 -
May's last week was very hectic. I had just finished my final exams and there were going to be semester project evaluations in that whole week.
@safiullah and me had decided to make a whole Social Network with all features in it, for the DB course project.
All other classmates were making small management systems like ticket booking and etc.
We thought that if we really wanted to learn DB concepts then we should come up with something different than a management panel.
Hence we did it. This was the first time we used a framework. Well, I had written that PHP framework while i was learning about how frameworks work and the way they are made. So it wasn't a big thing but it was something which could be used as a base for clean and organized code.
It took about a month of commits and pushes and it resulted in a very good social network. It had all the features and algorithms present in a starter social network.
For us students, we were happy to see what a fine job we had done. We learnt a lot and used new concepts.
When we went to the instructor, she asked us to sit down and show the project. @safiullah placed the laptop, and logged out from the social network so that he could show her a demo.
She exclaimed,"Why did you do it (Log out) ?"
He replied: "To show you how it works🤷🏻♂️"
She:"Get to the previous state and leave it"
Then she asked different questions like what was a post request in php and how it differed from get? what library for DB connection was used... etc.
We explained each and every step.
She saw the frontend design and said "You've just added text to the elements" as If we were showing her a theme demo with hard coded text accomplished by inspect element.
She did not take a look at any other page than the one we had shown her at start. She navigated to no other page and asked nothing about what total features were implemented and how they were done?
Then she said Thank You and we left.
After some days marks were uploaded in LMS and we were just two points above the average.
She took no look and gave us the least when our project was the best.
I'm 100 percent sure she thought that we were showing her a project copied from somewhere else. 🤣4 -
At work, when I try to find the best place to implement some code, I read the current code to get why it's here, and if I'm at the right place to do my stuff.
Sometimes the previous dude writes a shitty code because, well, Drupal 8 and he didn't have much choices to make his stuff work.
But some other times just reading the code feels like double checking if I did all my vaccinations. When these moments occure, I activate the annotate mode in PHPStorm so I can see who wrote this piece of dumb shit code, so I can insult him in my head while doing my stuff.
Sorry pal, I'm not paid enough to write a WORKING code for you at your place, but at least you'd know that if you were drowning, I'd share my point of view about this planet's overcrowding. Fucker. -
After reading mostly sad (and astonishing!) stories, I didn't really want to share my story.. but still, here I am, trying to contribute a wholesome story.
For me, this whole story started very early. I can't tell how old I was but I'm going to guess I was about 5 or 6, when my mom did websites for a small company, which basically consisted of her and.. that's it. She did pretty impressive stuff (for back then) and I was allowed to watch her do stuff sometimes.
Being also allowed to watch her play Sims and other games, my interest in computer science grew more and more and the wish to create "something that draws some windows on the screen and did stuff" became more real every day.
I started to read books about HTML, CSS and JS when I was around 10 or something. And I remember as it was yesterday: After finishing the HTML book I thought "Well that's easy. Why is this something people pay for?" - Then I started reading about CSS. I did not understand a single thing. Nothing made sense for me. I read the pages over and over again and I couldn't really make any sense of it (Mind you, I didn't have a computer back then, I just had a few hours a week on MOM-PC ^^)
But I really wanted to know how all this pretty-looking stuff worked and I tried to read it again around 1 year later. And I kid you not, it was a whole different book. It all made sense now. And I wrote my first markups with stylings and my dream became more and more reality. But there was one thing lacking. Back in the days, when there was no fancy CSS3. It was JavaScript. Long story short: It - again - made no fucken sense to me what the books told me.
Fast forward a few years, I was about 14. JavaScript was my fucken passion, I loved it. When I had no clue about CSS, I'd always ask my mom for tips. (Side story: These days it's the other way around, she asks me for tips. And it makes me unbelievably proud!)
But there was something missing. All this newschool canvas-stuff wasn't done back then and I wanted more. More possibilities, more performance, more everything.
Stuff begun to become wild. My stepdad (we didn't have the best connection) studied engineering back then, so he had to learn C. With him having this immensely thick book for C, I began to read it and got to know the language. I fell in love again. C was/is fucken awesome.
I made myself some calculators for physics and some other basic stuff and I had much fun using and learning it. I even did some game development, when I heard about people making C-coded games for PSP. Oh boy, the nights I spent in IRCs chatting with people about C, PSP-programming and all that good stuff, I'll never forget it - greatest time of my life!
But I got back to JS more and more and today I do it for money and I love it. I'll never forget my roots and my excurse into the C/C++ world and I'm proud to say, that I was able to more or less grow up with coding and the mindset that comes with it.1 -
Like 4 years ago I worked in a company as IT that used a windows desktop app with SQL Server 2008 (yep that old) to manage their sales, this app was written in WPF, the app was good because it was customizable with reports
One day the boss wanted to keep extra some data in the customer invoice, so they contacted the app developers to add this data to the invoice, so they they did it, but it in their own way, because the didn't modify the app itself(even if it was an useful idea for the app and companies that use it) they just used other unused fields in the invoice to keep this data and one of the field that the boss was interested was currency rate, later I verified in the DB this rate was saved as string in the database
The boss was not interested in reports because he just wanted to test it first and let time to know what the boss will need in the reports, so at the of the year they will contact again the devs to talk about the reports
So is the end of that year and the boss contacted the devs to talk about the reports of the invoices using the currency rate, this rate was just printed in the invoice nothing more, that's what the boss wanted that's what's the devs did, but when asked to do the reports they said they could'nt because the data was saved as string in the DB o_O
Well, that was one the most stupid excuses I ever heard...
So I started to digging on it and I found why... and the reason is that they were just lazy, at the end I did it but it took some work and the main the problem was that the rate was saved like this 1,01 here we use comma for decimal separator but in SQL you must use the dot (.) as decimal separator like this 1.01, also there was a problem with exact numbers, for example if the rate was exactly 1, that data must be saved just 1 in the field, but it was saved as 1,00 so not just replace all the commas with dots, it's also delete all ,00 and with all that I did the reports for my boss and everyone was happy
Some programmers just want to do easy things... -
Story of my first successful project
Being part of a great team, I've shared in a lot of successes, one I am particularly proud of is my first attempt to use agile methodologies in a deeply waterfall-managment culture.
Time was June/July-ish and we applied for a national quality award where one key element in the application stated how well we handled customer complaint resolution.
While somewhat true (our customer service is the top-shelf good stuff), we did not have a systematic process in resolving customer complaints. Long story short,
the VP lied on her section of the application. Then came the 'emergency', borderline panic meeting (several VPs, managers, etc) to develop a process to better manage
complaints before the in-house inspection in December.
As most top priority projects go, the dev manager allocated 3 developers, 2 DBAs, and any/all network admins we would need (plus all the bureaucratic management that wanted their thumb in the pie).
Fast forward to August, after many, many planning meetings, lost interest, new shiny bouncing balls, I was the only one left on the project. The VP runs into the dev manager in the hallway and asks "Is my program done yet? If its not ready before December with report-able data, we will not win the award."
The <bleep> hit the fan...dev manager comes by...
Frank: "How the application coming along? Almost done?"
Me:"No, haven't really started coding. You moved Jake and Tom over to James's team, Tina quit, and you've had me sidetracked helping other teams because the DBAs are too busy."
Frank: "So, it's excuses. You really think the national quality award auditors care about your excuses? The specification design document has been done for months. This is unacceptable."
Me: "The VP finished up her section yesterday and according to the process, we can't start coding until the document is signed off."
Frank: "Holy f<bleep>ing sh<bleep>t! No one told you *you* couldn't start. You know how to create tables and write code."
Me: "There is no specification to write to. The design document is all about how they plan on reporting the data, not how call agents will be using the application to serve customers."
Frank: "The f<bleep> it isn't. F<bleep>ing monkeys could code against that specification, I helped write it! NO MORE F<bleep>ING EXCUSES! This is your top priority from now on!"
I was 'cleared' to work directly with the call center manager and the VP to develop a fully integrated customer complaint management system before December (by-passing any of the waterfall processes that would get in the way).
I had heard about this 'agile' stuff, attended a few conference tracks on the subject, read the manifesto, and thought "I could do this.".
Over the next month, I had my own 'sprints' and 'scrums' with the manager (at the time, 'agile' was a dirty word so I had to be careful of my words and what info I shared) and by the 2nd iteration had a working prototype.
Feature here, feature there (documenting the 'whys' and 'whats' along the way), and by October, had a full deployed application.
Not thinking I would get a parade or anything, the dev manager came back from a meeting where the VP was showing off the new app to the other VPs (and how she didn't really 'lie' on the application)
Frank: "Everyone is pleased how well the project turned out, except one thing. Erin said you bothered him too much with too many questions."
Me: "Bothered? Did he really say that?"
Frank: "No, not directly, but he said you would stop by his office every day to show him your progress and if he needed you to change anything. You shouldn't have done that."
Me: "Erin really seemed to like the continuous feedback. What we have now is very different than what we started with."
Frank: "Yes, probably because you kept bothering him and not following the specification document. That is why we spend so much time up front in design is so we don't waste management's time, which is exactly what you did."
Me: "We beat the deadline by two months, so I don't think I wasted anyone's time. In fact, this is kind of a big win for us, right?"
Frank: "Not really. There was breakdown in the process. We need better focus on the process, not in these one-hit-wonders."
End the end, the company won the award (mgmt team got to meet the vice president, yes the #2 guy). I know I played a very small, somewhat insignificant role in that victory, I was extremely proud to be part of the team. -
So here's why I'm irritated ,
Day 1:I got a call from a company about an internship from a mutual contact they wanted to build an Zomato kind of application for retailers the person asked me to do it in react native which i didnt know and so I said i have experience with Android development i can do it in android he wanted a multi platform based development well i said i could learn but i haven't work on such a big project I'm still a student I'm a freshers so i didn't have the confidence to say yes so he gave me two day to make up my mind.
Day 2: I called him back i said I'm ready to develop the application I'll learn like crazy but i wont miss out on this opportunity so he was like we are not interested in react anymore we are thinking about going android and ios native I'm like great that i can work with but he shifts to I'm still thinking about flutter as well I'm like I know a lil flutter i had attended few conferences in it he asked can you brush up and I'll call you up tomorrow .
Day 3 : so he called me today and was ya so did you brush I'm like yes I'm ready to start working i need to work on my dart but as an expected internship I'll work on the development as I learn I'm totally in he said how long would it take I said I'm not confident 2,3 weeks but i could definitely provide you with what you want I'll work my ass off .He says fine then learn flutter first get back to me then we will think about it . I'm like ahhhhhh
So please what did i do right what did i do wrong can anyone please tell I'm a noob i need to learn a lot of things would appreciate your feedback
What should have i done here?7 -
Have you ever worked for an organization that is not specialized in software development because that is not their main line of business, however, their products are software applications?
If you are, then hi you and me are in the same boat. Currently I have a nice manager and I'm acting as dev lead the strange thing I have a peer that is supposed to be lead as well but I cannot define his position....
In theory he should be scrum master / resource manager which fails at both terribly.
I ended up implementing Agile in the team and deciding what goes and not into the sprint based on quality while this guy just try to squeeze stuff into the sprint, the more the better even with all kinds or problems...
Honestly I'm not sure why he is still in the team since it seems like he only drains the budget, doesn't understand a thing about the products he is working on and every single idea he has is horrible.
Every meeting I have with him I always ended up asking myself "How can somebody be that stupid?" The lack of technical knowledge and even common sense is over 9000 in this one...
It might sound bitter from my end but after two years of dealing with this stupidness of getting people in software development that have no idea what software development is and understand the intricacies of it just because they did an access database or are good at excel is nonsense.
I'm at the verge of quitting and the only thing that is keeping me here is my manager and the fact that the products I am working with are pretty interesting.
Sorry for the long rant but I had to get it out of my chest before it explodes and I directly call out this person.
Not looking for suggestions but if anybody want to chime in go ahead.1 -
Mid - senior dev (L from now on) comes in on a project to help out. Starts working on creating a dashboard for the application. Work is progressing, new ideas come in, team lead (TL) is ok with everything, business analyst (BA) is also ok. The dashboard even gets thru testing (T), everything is great. In comes (A), a (probably bored) junior backend dev.
A little backstory about (A):
- seated right next to (TL)
- most discussion about every developed feature take place at (TL)-s desk, right next to (A)
- (A) was also present when discussions took place between (TL) and (BA) about dashboard
- (A) could have easily heard any number of the other team members (over 15) talk about the dashboard
Well, (A) comes into the picture ... and the dashboard (first page after login, big shiny new thing, working just fine ...) breaks. Well, breaks is a little understated. Disappears would be more exact. Cause (A) commented it out. NOT deleted from code. JUST commented out the code.
But why you ask? Because he didn't know what it did and why it was there.
No asking around, no looking up history in repository, no looking up tasks that might be related to that ... no nothing.
He's a backend dev, there's something new and unknown in the backend, the new thing has to go.
(L) didn't scream, (TL) didn't scream, (BA) didn't scream, (T) didn't scream ...
I almost screamed. This didn't happen to me, or (A) would have screamed!3 -
Jfc why do phone meetings always have like 20 cumulative minutes of radio silence? I swear, I ask a question and I may as well be listening for a pin to drop over there because no one in team leadership is saying a n y t h i n g.
It's upsetting because it makes me painfully anxious because Oh God What Did I Say but more than that, it feels like this huge waste of time to just...sit there. On the phone. And then when we go over time later in the middle of pointing a user story leadership's like, "Hey, can we wrap this up?" like sorry? That's not...my fault? I'm...
And I totally get it if you can't answer my question immediately, but if it takes you more than like a minute to come up with something just gimme a, "I'll get back to you on that," and move on. No need to wait for the end days, dude. We've got lives to live and better things to do, Clearly.3 -
YouTube... for video creation.
Now I know I was a really amateurist video maker trying to make tutorials and videos about his coding creations in Mugen (you know, CNS state controllers and stuff,...), but this is the kind that's hard to get views from if you don't have a reach long enough to appear in search pages. I've had fun tagging my videos with plenties of tags just so they appear someday as a relevant result. EVEN in search pages for videos in the week, they barely appear and are sunk under videos of your Nth Mugen KOF clone with broken chars, Mugen ryona, Mugen hentai,... Speaking of which, did you know someone got to one of my videos from one of these?! How does YouTube's recommendation system work at this point?!
In the meantime (more like recently), I've been more interested in Ikemen, still kinda Mugen, still a DSL for a game engine, but still fascinating and there's material for tutorial making. But if I ever went back on video making, that won't be on YouTube. I'll just stick on Twitter and Discord if I were to share my content. At least, I got people following me there and a base visibility over there to start with. I could consider forums as well, why not, but YouTube is a no-go for me now.3 -
!rant
[Update on previous rant at the bottom]
So I had the technical test last friday. I did not try to implement any automated test as it is not my forte.
I had three hours to showcase my knowledge of data structures and OOP so I did that.
The test was somewhat long actually, so I left out one part that I did not have time to implement: validation of input files.
Today I got feedback, everything went well, they liked my code and I only got two negatives: Error handling and automated tests xD
Now I'm going to the second phase: phone interviews and they are gonna asks the whys of my implementation.
I'll have to explain why I did not implement automated tests and the girl on the phone told me "they didn't like it much that you had no tests because tests are very important for us".
I guess I'll have to come clean and say that I'm not very strong on that but willing to learn, so I didn't want to risk it doing something I'm not really good at.
I hope it ends up well.
prev rant:
https://devrant.com/rants/1607302/...4 -
Having to hold hands.. dudes been here nearly a year, and I still have to walk him through things. Keep in mind this guy apparently has prior experience. It goes like this:
Him: this process is failing and I don't know why.
Me: did you check the logs?
H: no.
M: ok well what about the code? Have you traced through to find where the error is happening?
H: no not yet.
Couple hours later..
M: Did you get that error sorted out?
H: no.
M: never mind, I'll take care of it. -
The life of a normal person is like waking up every day with a zero on the scale of suffering. You did something good — here are -20 points to that scale. Something bad happened — well, here are +10 points. Being a bipolar person, my life is like beginning every day with +500 suffer points. Every day is a devastating uphill battle to just break even.
Why live then?
You can't win. If you have a healthy sleep schedule, do sports and eat healthy, it's still +500 every day. One mistake like fucking up your sleep schedule — boom, you now start at +700.
In Japan, a new breakthrough in psychiatry is happening as they were able to tie bipolar disorder to a HHV6 herpesvirus messing up the operation of Parkinje cells in human brain, unreachable to the immune system because of blood-brain barrier. A nasal spray treatment is proposed. If successful, bipolar disorder could be cured forever.
Until an actual nasal spray is released, I decided to wait because it's a huge bummer killing myself only some three years before this breakthrough.
But if their experiments will never come to fruition and my conventional therapy will not be successful, I will kill myself.
I don't want to live like this.4 -
I have no specific story to tell (for now. Will post ke if i remember one) but i have had tons of CS teachers that are shit. From ones who don't know shit to ones who are so bad as a human being i am sure thrte are hundreds of people out there to kill them. I have had multiple teachers where all they did was read out a book and we'd have o site everything they read. Whole fucking semester. And not just one person or once. M-U-L-T-I-P-L-E TIMES AND TEACHERS. then I ve had ones who would rejection my code even if it's better, is right, can andle more edge cases, most likely magnitfrs of times faster and isn an eye sore with just effig if-else on op of if-else nested within if-else with many for loops. Then there are those who want you to do just what they want and expect you to not have a life of your own. Those who blatantly abuse their powers. Those who couldn't care less. Those who are not that bad a teacher but their attitude and style just makes you want to leave. There's one currently who wants a group of 4 people in second year to develop a full blown industry level application in mere 3 weeks. AND WE ARE HAVING OUR THEORY PAPRRS INBETWEEN FOR 2 EFFING WEEKS. So that's just like a month. Fortunately I have a group that's good enough that I can have them do the testing and filling up the documentation (did I mention that he needs full documentatiin for software plus a report on how our development process) and have them work on presentation (yup. We need to present this thing) all for just 50 marks. 1 uni credit. Our system still gives 80% weightage to pure theory. Plus the practical part is somewhat theory too.
Our HOD wants us *insists*forces** to stay back at college and work on projects (which is nice but what he ments is use the shitty outdated books from early 2000s to study something). Now I'd be happy to stay back if college provided decent internet (I am not asking for gigabit speeds. Even 1-2Mbps would work) and place to sit. But nope, our college non-teaching staff is eager to send us out of their department and by extention college building. There is literally nowhere you can sit. Plus yup, there is no internet and nowhere for you to plug your laptop in. That's a moot point anyway because they don't want you to use your laptop in college library or anywhere anyways. Plus you don't get much of mobile data too because of the building design. Those work only near windows. Why would I be at college if I can get a 50+Mbps down, area to sit, snacks, port to charge all at home. And you'd say we should talk with him about this – well it's not his issue is all he has to say.
Well, such is life in Indian colleges. And my college/uni is one of the better ones.1 -
Whenever I see the name @CoffeeBoy come up I think to myself:
-Umm hey I think we just ran out of coffee,
-Aw shit and we are working overtime till we finish.
-Are you thinking what I'm thinking ?
-Are you thinking about how good it would be to be a cat.
-Uuh no why do you want to be a cat ?
-Well duuh cat's sleep all day. It's great !
-They also live for only 15 years so I would think in total you will sleep more than cats do.
-You like to ruin things for me don't you.
-I call it productive refactoring. But getting back on topic. I hear we have a new intern ?
-Yeah, that's Jim over there.
-Well lets tell him to get us coffee.
-Oh yeah that's a good idea, because interns already have the bare minimum of expectations from their life anyways !
-Hey Jim, yeah you Jimmie buddy can you get us a few cups of coffee we really need those to stay functioning right now.
-Yeah sure, what do you need.
-George drinks cappuccino, you can get me whatever. Thanks man here is the money. Buy yourself a cup too it's on me.
-Oh thanks.
*Jim walks out of the room*
30 minutes has passed...
-Dude where is Jim at ? It shouldn't be that hard to get 3 cups of coffee from just a few blocks away.
-I hope he didn't get robbed or something he has MY money on him.
*22 minutes ago, jim walks out of the coffee shop carrying the 3 cups securely held under his arm *
-I thought he was just gonna use me as an errand boy or a coffee boy to be exact in this case. But it's nice of him to also pay for my cup. Maybe they are not such bad--
His sentence got cut off by the sudden impact with a metal surface at high velocity. He got hit by a car while he was crossing the street, too deep in thought to notice the speeding car in time.
After hitting Jim the car suddenly come to a halt with a screech noise from it's tires.
But it was too late the impact shattered his lower spine. Leaving a blodied body on the ground. Coffee from the smashed cups merged with his blood. Little did anyone know that day would be the birth of a new hero.
He,he,he he is the COFFEE BOY,
Fighting the evil villain Sleep Deprivation day and night, but mostly night. And his sidekick Mugatron always covering for Coffee Boy !!! -
It's been a good month where honestly I had nothing to rant about. Pretty much doing my own project setting up ELK.
But last few days I had to return to the reality called teammates....
It where it ok... I mentored one of them, then did the code review yesterday
And that's when the shit hit the fan.
I told them to do X but then they did Y instead thinking that they were smart.
In hindsight they seem to have no idea wtf they were doing, inexperienced and couldn't even use console.log and JSON.stringify to debug object states...
Which course now reminded what's wrong with this team, you got people jumping around stacks and projects so they're all mediocre on all of them. Rather than having specific people being good at one of them (aka more experienced than a noob).
And if course this morning, manager asked me to look into something on a program I haven't support in a while (there are a free people that are more experienced and know the current state better). And he said this is quick and urgent... And actually when he said that I'm like uh.... don't think so....
And last thing is we had to rerun a report in production so needed the shipper ten to do it. Asked them look yesterday, users were waiting.
Today... Still not done. And well I actually can run the report myself locally.. takes 5mins but in production they need to reload the data but that should take at most 20mins... Either way... Nothing was done.
Oh and I just remembered I raised a request to it SA group to have some not script installed... That not done either.
And this is why relying on others it at least these people is a bad idea..... Unless your are capable of firing them... -
That feeling when you inherit a script to automate something that takes 10 seconds. Why would they even write this? It's not like the task is hard....
...
And why would they write it this way? I'm sure if I just move this part and ....
That feeling when you spend several hours improving and redesigning a perfectly functional script to automate a 10 second task for zero gain aside from cleaner code. "But the code for this quick-and-dirty script I'm never going to look at again looks so much better now!"
... If only it did a bunch of complicated parsing, regex matching, and error checking just so I can answer one less prompt.... Unless that parsing fails. Then it should still ask me for that prompt... And also validate that the answers I give are valid and correct....
That feeling when you spend a whole nother day starting from scratch to implement error checking and complex parsing logic knowing full well the original task takes 10 seconds to do manually and is needed at most twice a day (for a grand total of 20s a day)
WHY AM I LIKE THIS?!?!?!4 -
"The Perils and Triumphs of Debugging: A Developer's Odyssey"
You know you're in for an adventurous coding session when you decide to dive headfirst into debugging. It's like setting sail on the tumultuous seas of code, not quite sure if you'll end up on the shores of success or stranded on the island of endless errors.
As a developer, I often find myself in this perilous predicament, armed with my trusty text editor and a cup of coffee, ready to conquer the bugs lurking in the shadows. The first line of code looks innocent enough, but little did I know that it was the calm before the storm.
The journey begins with that one cryptic error message that might as well be written in an ancient, forgotten language. It's a puzzle, a riddle, and a test of patience all rolled into one. You read it, re-read it, and then call over your colleague, hoping they possess the magical incantation to decipher it. Alas, they're just as clueless.
With each debugging attempt, you explore uncharted territories of your codebase, and every line feels like a step into the abyss. You question your life choices and wonder why you didn't become a chef instead. But then, as you unravel one issue, two more pop up like hydra heads. The sense of despair is palpable.
But, my fellow developers, there's a silver lining in this chaotic journey. The moment when you finally squash that bug is an unparalleled triumph. It's the victory music after a challenging boss fight, the "Eureka!" moment that echoes through the office, and the affirmation that, yes, you can tame this unruly beast we call code.
So, the next time you find yourself knee-deep in debugging hell, remember that you're not alone. We've all been there, and we've all emerged stronger, wiser, and maybe just a little crazier. Debugging is our odyssey, and every error is a dragon to be slain. Embrace the chaos, and may your code be ever bug-free!1 -
Okay so there are a lot of things that are left by us students as "this would be taught to us on job, why bother now?" So i have many questions regarding this:
- is it a safe mentality? I mean University is teaching me, say a,b,c and the job is supposed to be like writing full letters, than am i stupid to stick to just a,b,c and not learning how to write letters beforehand?
- what is even "taught" on job? This is especially directed towards people in Big firms. I mean i can always blame that small ugly startup who treated me badly and not gave me any resources, but why do i feel its going to be same at every other company?
I guess no one is gonna teach me for 6 months on how to write classes with java, or make a ml engineer out of me when i don't know jack shit about ml.... That's the task for college, right?
I feel that when these companies say they "teach", you they mean how to follow instructions regarding agile meetings, how to survive office politics and how to learn quickly and produce an output quickly. I don't think that if i don't know how MVI works, then they are gonna teach me that, would they?i guess not unless they already have someone knowledgeable in that topic
- what about the things that are not taught in our colleges and we wanna make a career in it? Like say Android. From what i have experienced , choosing a career in a subject that's not taught you in grad school immediately takes away some kind of shield from you, as you are expected to know everything beforehand. So again, the same questions bfrom above
i did learned something from job life tho, and that too twice. Once it was when i first encountered an app sample for mvvm and once when i found out a very specific case of how video player is being used in a manner that handled a lot of bugs.
Why i didn't knew those approaches when i was not in job? Well, the first was a theoretical model whose practical implementation was difficult to find online that time and the second was a thing that i myself gave a lot of hours, yet failed to understand. However when i was in the company , i was partnered with a senior dev who himself had once spent 30 days with the source code to find a similar solution.
So again , both of above things could have been done by me had i spent more time trying to learn those "professional tools" and/or dwelve deeper into the tech. And i did felt pretty guilty not knowing about those...5 -
TypeScript types are fun. Problem is: the check is compile-time only.
I just wasted an hour not understanding that an integer passed from command line was actually getting transmitted as a string. The library, where that value landed as parameter, happily ignored the non-matching type and worked as if the value has not been set at all!
Dear library maintainer, please enforce your parameter types! Throw an error right into my face saying I shall not pass anything but an integer! Don't just continue to work to produce false output correctly. Thank you!
Dear TypeScript, I really want type checks on runtime.
Dear JavaScript: Why did you ever think loose types were a good idea? (And I say that as a PHP developer as well.)2 -
A couple fucking brutal, merciless dungeon moments.
So first, we were having a chill kind of session. Throwing lots of jokes and shit, and I rolled with it. The baddie for the day, I felt inspired, and named him Fawq El-Fuqer, which yes, is very unfortunate.
Anyway, we avoid his goons and reach his impenetrable fortress of chronic masturbation, and it goes as well as you think. The rogue says hey, we gotta get him with his pants down (pause) literally. The cleric is skeptical at first, but she comes around to it.
And so we do it. I spin this tale of a man who's got a schedule tighter than his fucking asshole. El-Fuqer meticulously plans his shits, he makes it a whole ritual, even gives it a special name: Mud O'Clock.
We wait for his alarm to ring, and spring into action while he's taking a fat stinking fucking dump. The warrior kicks down the bathroom door and corners El-Fuqer while he's on the shitter, demanding satisfaction for their past romantic involment that's been strongly been hinted at, you see, she said Fuck the Fucker and I, that's history. And that's enough for a subplot if you ask me.
So where was I? Ah, yes, the rogue bursts in through the window shouting out "Mud O'Clock MOTHER FUCKER!!" and we immortalize the moment in the finest silks. The wizard then does a little Bane impression for some reason and a multitude of loud 'plops' are heard as El-Fuqer evacuates the entire content of his putrid guts.
He gets roughed up a little, you know nothing like interrogating someone after they nearly shit themselves to death. We reveal some oooh so unexpected plot twist about a portal to goddamn hell and it's like well, crap, we gotta do something about that. So the wizard and the rogue leave to give the warrior and El-Fuqer some, ehem, space to settle their score.
What followed was the most unexpected, most brilliant part of the whole session. She didn't just execute him in a brutal, gruesome manner, no, she went full fucking throttle. Forced El-Fuqer to eat his own cock and balls while sewing his ass shut, then had a bowl of bull testicle salad to drop a montanious fecal cake of biblical proportions upon his face.
Believe it or not, we made it into an emotional moment. Because everyone was shocked by how brutal the affair was. Warrior had a mental breakdown like, uuuh, I'm becoming the monsters I swore to fight ooh no. She starting shaking and crap, ran away and hid in an alley to weep, it begins raining and it's getting very dramatic, so I cook up some spirit of sorrow that goes in and helps her face her fears and shit through the power of friendship or whatever.
Moving on to second moment, this is shorter but I like it best. The cleric and another two extras went to an old shrine to try and prove the wizard wrong about his denial of prophecy. Thing is, they did the ritual wrong. And I'm usually very forgiving but I was feeling nasty after the whole sowing of the asshole thing. So I'm like, uh, I gave you fools VERY PRECISE instructions on how to perform this ritual, and you just did some wacky prayers to the moon nonsense, that's idolatry in-universe and out-of-universe too (depending on who you ask).
So I said fuck it, you guys had it coming. I whip out immortal ten-thousand year old elder sorceress bitch guardian of the holy sphincter, and it gets real pretty fucking quick. She's got sanctified heavy plate armor, blue fire torches coming out they fucking pauldrons, argent greatsword of anal judgement plus infinity, all the juiciest shit.
Anyway, the sorc descends from the sky in a pillar of azure flames and is like yo, drop that idolatrous shit right now or I'm gonna kill you all. They mistake her for angel or some shit, and are like hey chill, we're the good guys. But the sorc doesn't give a shit, and she says shut the fuck up or I'll send you to the Night Eternal, bitch.
I dunno why but the cleric and the other two extras don't get it, so they insist with the whole heyyyy we are not idolaters, we're your friends, we are questing for the mandinga mandango mcguffango. So she bisects one, breaks the neck of another, and decapitates the fucking cleric. It was awesome.
So what did we learn? idk, don't plan your dumps and don't pray to the fucking moon if you're standing on hallowed ground. *****9 -
I don't often have reasons to rant, but today is the one.
We had a deadline to finish a project, because today people are being trained on it. I've been working my ass off on it for a year now.
I "finished" about 2 weeks ago, meaning QA could start for real 2 weeks ago. As you can imagine for a project this long, there was bugs. Lots of them.
We did our best to fix most of them, or find work-arounds we could use during the demo.
Let's just say it isn't going great so far. We have several known bugs, which at some point may crash the app, a very low confidence in the fact that it's going to work well.
Oh and obviously the client is one who already use heavily the solution. Today we figured we never tested on a device with 0% disk space. Files are cut partway because of that, and obviously things crash.
I have a feeling there will be yelling sometime soon.
Right now I'm enjoying the calm before the storm, with coffee in hand.
Why do people still continue to promise dates to clients, after me telling them for 5 years not to do that?
We are a 2 devs team, with 11 apps on 2 platforms, 2 back-ends (one is legacy) and obviously our marketing site, which doubles up as e-commerce. We just can't promise anything, because any emergency reduce our development bandwith for new features either to 50% or 0%. There are so much known bugs it's not funny anymore, and we don't even have time to solve those.
To add insult to injury, at the beginning of the month, the SaaS provider for our legacy back-end (which have not been maintained for 2 years now) decided we had to update to PHP7.1 before 1st October. If we don't do anything, on monday this thing is broken. I hate that thing, and I hate having to maintain it even though I was promised I wouldn't have to ever have anything to do on it.
Monday will be "fun"...2 -
I've just joined a new company out of despair after several month out of jobs without being able to even get interviews.
I've been warned about the code being a bit behind with modern Android stack, they needed to migrate from rx to coroutine and compose is not a priority at the moment.
Fine with it, I like handling and planning migration, that's a nice challenge.
But if only that were the only problems !! Far from it, the code is a formidable mess, I've never seen so much amateurism... Most of it was written from the previous Lead Dev who stayed there for years and touched everything with their very bad practices.
I don't even know where to start honestly...
While the code is in Kotlin, it stink Java. Nothing wrong about Java, but if you code in kotlin, you need to understand what kotlin try to achieve. And that's not the case here. There is freaking nullable everywhere, for no reason at all, the data classes contains lot of var in their constructors, equals are override to compare only one or 2 params and no hashcode override with it.
Sealed class, what for ?! Let me just write a List<Pair<Enum, Any>> and cast your any depending on the enum !
Oh and you know what, let's cast everywhere, no check, and for once no null safe, there is enough nullable in the code !
What about the reactive part ? well let's recreate a kind of broken eventbus with rx ! Cause why not ?!
The viewmodel observable don't contain data, they just contain enum for the progress of the states we're checking.
In the viewmodel function we update that enum states and emit it to be observed and make the data available as a var for the view to pick it up when needed.
But why put the business logic in the viewmodel, let's put in the views, and grab and check the variable contain in the viewmodel whenever it fits.
Testing the business logic ? uh let me just test my variable initialisation in the viewmodel instead.
The vm, the views, make about 2000 lines, the test over 3000, and not a single test really test the business logic in it ! I've made big refactoring we're all the tests stayed green, while the function are full of side effects ! WTF ?!
Oh and what about that migration from rx to coroutine ? well better not break the existing code and continue writting like rx, everything is cold flow ! We just need to store a boolean saying if we already did our call to the data layer then we decide to start our flow or not.
As for the RecyclerView, having too many viewHolder is just so annoying, let's put all our different views in one, and hide what we don't need.
Keystore has been push on the repo, but it's private no ? So who cares ?!
And wait i'm not done ! Some of the main brick of the apps depends on library that hasn't been updated for years, and you know what... yes they were hosted on Jcenter and it's only now that they decide to do something about it, we we're warned about the sunset of jcenter 2 years ago !!!!
So what about compose ? What do you want with compose ?! there is no design system in that app obviously, so don't even think about it !
And there... among all of that mess, I'm supposed to do code review... how the fuck do you do a code review when all the code that is around stink ?!
And there is so much more but by now I'm afraid you're thinking i'm just pissing on the old code like everyone... but damn I guarantee, that's the worst code I've ever seen, and i've work on more than 15 app from small to big on different contract with a lot of legacy code, but nothing that bad !1 -
tech bros be like treesitter this treesitter that and bla bla bla buh blah bawa and honestly fuck that shit
I mean, it's great concept shit but down to earth it's a clusterfuck
meaning if you actually want a decent mofo of a highlight you might as well write that query file yourself just as I did for python, markdown, bash, rust, zig, typescript... Like, shit, you dumb fucks be writing a shit ton of unmanageable, unformatable s-expressions, fucking up my editor's performance. I AM NOT KIDDING, fuck! Original bash highlights.scm's like 300 LOC of smelly patchwork and mine's like 100, shat in a single sitting that actually follows the damn fucking language spec. Do you think I'll waste my time contributing with my queries? NO FUCKING WAY! Why not, buddy? Well, cuz I FUCKING DESPISE one of the projects core maintainers. Asscrack piece of shit asshole. BUT if you treesitter bros out there ever get rid of that cockroach of a man make no mistake I'll take that shitheat's place and front the project the codes -
So I got the new macbook pro 15 with touchbar .... this is my first macbook that I have ‚issues‘ with.
* the new butterfly keaboard doesnt feel as good as the old one
* ... abd its friggin loud!
* the keyboard backlight just randomly drops out and forces me to cold reboot WTF??
* they bigger left/right cursor buttons make it so hard to feel where you are, that I constantly confuse up and down
* the touchbar is basically unusable for a keyboard centric person like me. It forces me too look down to the keys!
* I constantly hit the esc bc im used to have one finger there to hit it if needed, but now im forced to hover it bc otherwise it is pressed
* and why of fucking why did apple remove magsafe??? Now i dont even see anymore if is is being charged without turning the screen on
* i hate the usb ports too, why not even add a free usbc to usba port? (Well, i guess bc it would make the macbook even more expensive... free wouldnt be free anyway i guess)
It is way more powerful though, but the time i would buy a personal one is over and will probably never come back.
Im a happy hackintosh user btw 😅3 -
Let's be honest - given the state of the world today, the more I listen to Megadeth, the more I relate to what Dave Mustaine has been pissed off about for a few decades now. Oh, you don't know who Dave Mustain is? He was, like, the 5th guy in Metallica. Rather, he was the bass player until he got fucked over because he was a dick and thrown off the first album Metallica did. Don't worry - he did OK. He formed Megadeth and still had quite a successful musical career. Why am I ranting about him? Simple - A lot of his lyrics are darker than Metallica's. I honestly don't know what the fuck I'm doing with my software/personal/professional life right now. I've got ideas & dreams, but all this COVID shit is just draining the fuck out of me. Sometimes I feel like I've failed - most of the lifeforms on this planet manage to procreate. Well, that didn't happen for me. On the down side, I didn't get to be a father. On the up side, I didn't punish the life of a child with my own brands of mistakes, ignorance, and stupidity. My life is littered with male failures. My biological father (paranoid, schizophrenic ) died at 58, doing everyone around him a favor. My grandfather on my mother's side died of colon cancer at 69 (so-called reformed alcoholic, manic depressive on lithium with great abusive tendencies). My step father who adopted me? Sure - he loved me. He just never understood me. "Computers are just a tool". Fuck you, 'dad'. Go play with your horses and tell me what I'm doing isn't meaningful. Where was I? Oh yes, almost killing myself last summer. I think between COVID and my own colossal screw ups & paranoia I went over the entire fucking edge. I pulled myself out of it with the help of medication, counseling, and learning to just let shit blow up because "it's not my problem". I'm still angry. Perhaps that's the only thing that keeps me going from time to time. I'll leave you with a quote from Ghandi - No, not that idealistic, limited one, Mahatma Ghandi. From his grandson, who managed to really pick up what he was putting down - Arun Ghandi:
“Use your anger for good. Anger to people is like gas to the automobile - it fuels you to move forward and get to a better place. Without it, we would not be motivated to rise to a challenge. It is an energy that compels us to define what is just and unjust.” -
TL;DR I just recently started my apprenticeship, it's horrible so far, I want to quit, but don't know what to do next...
Okay, first of all, hey there! My name is Cave and I haven't been on here for a while, so I hope the majority of you is doing rather okay. I'm programming for 6 years now, have some work experience already, since I used to volunteer for a company for half a year, in which I discovered my love for integrations and stuff. These background information will probably be necessary to understand my agony in full extend.
So, okay, this is about my apprenticeship. Generally speaking, I was expecting to work, and to learn something, gaining experience. So far, it only involved me, reading through horrible code, fixing and replacing stuff for them, I didn't learn a thing yet, and we are already a month in.
When I said the code is horrible, well, it is the worst I have ever seen since I started programming. Little documentation - if any -, everywhere you look there is deprecated code, which may or may not been commented out, often loops or simply methods seem to be foreign for them, as the code is cluttered with copy paste code everywhere and on top of that all, the code is slow as heck, like wtf.
I spent my past month with reading their code, trying to understand what most of this nonsense is for, and then just deleting and rewriting it entirely. My code suddenly is only 5% or their size and about 1000 times faster. Did I mention I am new to this programming language yet? That I have absolutely no experience in that programming language? Because well I am new and don't have any experience, yet, I have little to no struggle doing it better.
Okay, so, imagine, you started programming like 20 years ago, you were able to found your own business, you are getting paid a decent amount of money, sounds alright, right? Here comes the twist: you have been neglecting every advancement made in developing software for the past 20 years, yup, that's what it feels like to work here.
At this point I don't even know, like is this normal? Did git, VSCode and co. spoil me? Am I supposed to use ancient software with ancient programming languages to make my life hell? Is programming supposed to be like this? I have no clue, you tell me, I always thought I was doing stuff right.
Well, this company is not using git, infact, they have every of their project in a single folder and deleting it by accident is not that hard, I almost did once, that was scary. I started out working locally, just copying files, so shit like that won't happen, they told me to work directly in the source. They said it's fine, that's why you can see 20 copies of the folder, in the same folder... Yes, right, whatever.
I work using a remote desktop, the server I work on is Windows server 2008, you want to make icons using gimp? Too bad, Gimp doesn't support windows server 2008, I don't think anything does anymore, at least I haven't found anything, lol.
They asked me to integrate Google Maps into their projects, I thought it is gonna be fun, well, turns out their software uses internet explorer 9.. and Google maps api does not support internet explorer 9... I ended up somehow installing CEF3 on that shit and wrote an API for it in JS. Writing the API was actually kind of fun, but integrating it in their software sucked and they told me I will never integrate stuff ever again, since they usually don't do that. I mean, they don't have a Backend as far as I can tell, it looks like stuff directly connects with their database, so I believe them, but you know... I love integrating stuff..
So at this point you might be thinking, then why don't you just quit? Well I would, definitely. I'm lucky that till December I can quit without prior notice, just need a resignation as far as I can tell, but when I quit, what do I do next? Like, I volunteered for a company for half a year and I'd argue I did a good job, but with this apprenticeship it only adds up to about 7 months of actual work experience. Would anybody hire somebody with this much actual work experience? I also consider doing freelancing, making a living out of just integrating stuff, but would people pay for that? And then again, would they hire somebody with this much experience? I don't want to quit without a plan on what to do next, but I have no clue.
Am I just spoiled, is programming really just like that, using ancient tools and stuff? Let me know. Advice is welcomed as well, because I'm at a loss. Thanks for reading.10 -
i am feeling angry and frustrated. not sure if it's a person ,or codebase or this bloody job. i have been into the company for 8 months and i feel like someone taking a lot of load while not getting enough team support to do it or any appreciation if i do it right.
i am not a senior by designation, but i do think my manager and my seniors have got their work easy when they see my work . like for eg, if on first release, they told me that i have to update unit tests and documentation, then on every subsequent release i did them by default and mentioning that with a small tick .
but they sure as hell don't make my work easy for me. their codebase is shitty and they don't give me KT, rather expect me to read everything on my own, understand on my own and then do everything on my own, then raise a pr , then merge that pr (once reviewed) , then create a release, then update the docs and finally publish the release and send the notification to the team
well fine, as a beginner dev, i think that's a good exercise, but if not in the coding step, their intervention would be needed in other steps like reviewing merging and releasing. but for those steps they again cause unnecessary delay. my senior is so shitty guy, he will just reply to any of my message after 2-3 hours
and his pr review process is also frustrating. he will keep me on call while reviewing each and every file of my pr and then suggest changes. that's good i guess, but why tf do you need to suggest something every fucking time? if i am doing such a shitty coding that you want me to redo some approach that i thought was correct , why don't you intervene beforehand? when i was messaging you for advice and when you ignored me for 3 hours? another eg : check my comment on root's rant https://devrant.com/rants/5845126/ (am talking about my tl there but he's also similar)
the tasks they give are also very frustrating. i am an android dev by profession, my previous company was a b2c edtech app that used kotlin, java11, a proper hierarchy and other latest Android advancements.
this company's main Android product is a java sdk that other android apps uses. the java code is verbose , repetitive and with a messed up architecture. for one api, the client is able to attach a listener to some service that is 4 layers down the hierarchy , while got other api, the client provides a listener which is kept as a weak reference while internal listeners come back with the values and update this weak reference . neither my team lead nor my seniors have been able to answer about logic for seperation among various files/classes/internal classes and unnecessary division of code makes me puke.
so by now you might have an idea of my situation: ugly codebase, unavailable/ignorant codeowners (my sr and TL) and tight deadlines.
but i haven't told you about the tasks, coz they get even more shittier
- in addition to adding features/ maintaining this horrible codebase , i would sometimes get task to fix queries by client . note that we have tons of customer representatives that would easily get those stupid queries resolced if they did their job correctly
- we also have hybrid and 3rd party sdks like react, flutter etc in total 7 hybrid sdks which uses this Android library as a dependency and have a wrapper written on its public facing apis in an equally horrible code style. that i have to maintain. i did not got much time/kt to learn these techs, but once my sr. half heartedly explained the code and now every thing about those awful sdls is my responsibility. thank god they don't give me the ios and web SDK too
- the worst is the shitty user side docs. I don't know what shit is going there, but we got like 4 people in the docs team and they are supposed to maintain the documentation of sdk, client side. however they have rasied 20 tickets about 20 pages for me to add more stuff there. like what are you guys supposed to do? we create the changelog, release notes , comments in pr , comments in codebase , test cases, test scenarios, fucking working sample apps and their code bases... then why tf are we supposed to do the documentation on an html based website too?? can't you just have a basic knowledge of running the sample, reading the docs and understand what is going around? do i need to be a master of english too in addition to being a frustrated coder?
just.... fml -
I got enrolled in 'extracurricular activity' in second grade of my elementary school. We were playing some games at first, but later teacher started to show us programming and explained the matter very well considering we all were 8 y olds. I got interested and while others would play games I was coding and solved assignments teacher gave us.
My family thought that computer will make me stupid, thinking it was made just for playing games. They promised me to get me the computer if I had highest grades in school. I did, not all of them but tried really hard to be the best, despite that I waited for years and still being close to have aced every subject in the meantime.
I got my first computer when I was 16.
Since that day I was constantly reminded that I am wasting my life away sitting at this stupid box.
Later when I got the job that was well payed, they acknowledged that they were wrong to do that for majority of my life.
My parents are unable to explain what I do at the job as they were never interested in what I really do. "Something with computers" is most common answer you can hear from them.
My parents are non-technical people and they still don't understand how that box works and God forbid that they buy something online. My father even rejects to use smartphone.
They also thought that I'm no college material despite always being in top 5 students of the year (not class, but whole year).
They had other plans for me, but I was aware of that and didn't gave a f00ck about what they want with my life. I knew what I want and that was all exactly opposite of what my parents would like.
I was not the child they wanted, but was good son, even helped them and worked student jobs to pay some bills and to help them financially and still they struggled so hard to find some flaw to my character and decisions just to make their point but more than often failed miserably and just proved how wrong they were and how they don't think anything trough.
Only one who really supported me was my elder sister as she knew I was doing the right thing! She also did it her way and I am proud of her as both of us were dealing with 2 tough customers.
long rant, but wanted to add one more thing, I was never into sport, but was training tae kwon do and was really into it and was decent at it among my peers. When I was going to national competition, on my way out of the house all I got from my parents was: "why are you even going there when you will immediately loose, is it just to travel a bit?"
TL;DR: my family supported me less in my life than worst phone call you had with IT support at your worse ISP!4 -
// Rant 1
---
Im literally laughing and crying rn
I tried to deploy a backend on aws Fargate for the first time. Never used Fargate until now
After several days of brainwreck of trial and error
After Fucking around to find out
After Multiple failures to deploy the backend app on AWS Fargate
After Multiple times of deleting the whole infrastructure and redoing everything again
After trying to create the infrastructure through terraform, where 60% of it has worked but the remaining parts have failed
After then scraping off terraform and doing everything manually via AWS ui dashboard because im that much desperate now and just want to see my fucking backend work on aws and i dont care how it will be done anymore
I have finally deployed the backend, successfully
I am yet unsure of what the fuck is going on. I followed an article. Basically i deployed the backend using:
- RDS
- ECS
- ECR
- VPC
- ALB
You may wonder am i fucking retarded to fail this hard for just deploying a backend to aws?
No. Its much deeper than you think. I deployed it on a real world production ready app way.
- VPC with 2 public and 2 private subnets. Private subnets used only for RDS. Public for ALB.
- Everything is very well done and secure. 3 security groups: 1 for ALB (port 80), 1 for Fargate (port 8080, the one the backend is running on), 1 for RDS postgres (port 5432). Each one stacked on top and chained
- custom domain name + SSL certificate so i can have a clean version of the fully working backend such as https://api.shitstain.com
- custom ECS cluster
- custom target groups
- task definitions
Etc.
Right now im unsure how all of this is glued together. I have no idea why this works and why my backend is secure and reachable. Well i do know to some extent but not everything.
To know everything, I'll now ask some dumbass questions:
1. What is ECS used for?
2. What is a task definition and why do i need it?
3. What does Fargate do exactly? As far as i understood its a on-demand use of a backend. Almost like serverless backend? Like i get billed only when the backend is used by someone?
4. What is a target group and why do i need it?
5. Ive read somewhere theres a difference between using Fargate and... ECS (or is it something else)? Whats the difference?
Everything else i understand well enough.
In the meantime I'll now start analyzing researching and understanding deeply what happened here and why this works. I'll also turn all of this in terraform. I'll also build a custom gitlab CI/CD to automate all of this shit and deploy to fargate prod app
// Rant 2
---
Im pissing and shitting a lot today. I piss so much and i only drink coffee. But the bigger problem is i can barely manage to hold my piss. It feels like i need to piss asap or im gonna piss myself. I used to be able to easily hold it for hours now i can barely do it for seconds. While i was sleeping with my gf @retoor i woke up by pissing on myself on her bed right next to her! the heavy warmness of my piss woke me up. It was so embarrassing. But she was hardcore sleeping and didnt notice. I immediately got out of bed to take a shower like a walking dead. I thought i was dreaming. I was half conscious and could barely see only to find out it wasnt a dream and i really did piss on myself in her bed! What the fuck! Whats next, to uncontrollably shit on her bed while sleeping?! Hopefully i didnt get some infection. I feel healthy. But maybe all of this is one giant dream im having and all of u are not real9 -
If there's one thing i love and hate about JS arrow functions, it's the fact that they don't have a 'this' to themselves--great most times, VERY horrible the few times you need 'this' and forget that little caveat. I just wasted more time than I'm proud to admit because I forgot that
-
I love linux because i dont have to forced to do frickin update like windows did.
Because i have an experience after update linux mint i cant even start the main GUI program. After boot only show blank console. It seem linux update broke the compatibility between my graphics card.
At least now i dont have to update because thats an option. The output of update is not different than windows.there is a chance you broke your OS.
But the struggle is when i need to install new app in linux. Sometimes need more than hour to find out why it doesnt work from the first time.
Any help here?
So this start from the office. In the office i usually use low spec laptop that work slowly. Then i found this IDE called rapidclipse. Its very promising with GUI builder and can build cross platform mobile app using only java built on top vaadin framework.
When i use it on low spec laptop hackintosh at office it work well although it take more time than other kind of eclipse and i dont need to install any kind of app again, just download-install-create new project-run on tomcat-work well.
Then i go to home to try this new tool , IMO my low spec PC still have more power to run something than old hackintosh. Because usually i use android studio with no problem. In the old hackintosh it went too long to build gradle only.
Then i install rapidclipse, then run desktop shortcut. Then it said i need to install correct java to use correct JavaFX.
After search on SO they said i must install jdk from oracle.
Ok so i got openjdk in my linux.wtf what is the different idk but dont have time to find out.
I install jdk from oracle.
Than finally can open the rapidclipse.
Wow , this gonna be fun.
Then create new project. Just a new project.
So im waiting. I see the progress at 10%. But still no increment on that.
I switch to other app for several minutes.
Then when switched back th app still at 10% and now is at no responding state. So i force close.
After that open rapidclipse again.
The previous new project can be opened. Yay, i think.
But so many error there. Omg.
So i create new project again.
But, but, i just repeated the first error then close again then try it again for several time. But still same output.
After an hour, i give up.
But still, why , just why it work like this. No error or whatsoever.
Back later i have a problem like this on different app.
Idkwhy.1 -
Been seeing some ridiculous dumbshit comments regarding war which piss me the fuck off so I'll address them here
---
"xyz country did not abide by the rules of war"
What RULES in WAR? WAR is WAR, there are no fucking rules! Anyone can kill anyone however he wants to!
"Using xyz is illegal in war"
What can be ILLEGAL in WAR? WAR ITSELF is fucking illegal you dipshits. You just made a crime legal, normalized it and called it WAR
"Doing xyz is a war crime"
WAR-CRIME? WAR ITSELF is a fucking crime you cuntfuck! You cant do further crime than participating in war! While you're legally doing that crime you might as well do anything else illegal because now everything is legal in war, there is no such thing as a fucking war crime
"Do not kill women children and the elderly in war"
Why the fuck do they get a free pass? How about the 18 year old, 25 year old? Its fine to kill them? Who the FUCK are you to say who can be slaughtered and who cannot? Get the FUCK off my dick you fucking dickriders. If some groups of people can be slaughtered THEN SO CAN WOMEN CHILDREN OLD FUCKS AND BABIES BE SLAUGHTERED! DONT GIVE A FUFK. Either stop the fucking war or dont complain who got slaughtered.
NO RULES IN WAR.
NO MERCY IN WAR.
Same way how recruiters show no mercy or compassion in hiring. They dont give a FUCK. They fuck with everyone and waste everyone's time. Same way in war. Fuck anyone. Slaughter anyone. OR. Dont begin the fucking war in the first place7 -
Obviously the top item on the table is NN, the "end users" from both sides of the connection on the net are for the saving it, and the middlemen that only own the "cables" want it to be repealed.
We have the solution to end this issue forever. It wont be easy, nor will it be fast.. unless certain "entities" team with us in secrecy. (There's a reason why certain "entities" have stayed silent regarding NN, due to agreements to not get involved due to the risk of backlash. AND if NN is repealed Those Entities cannot fix the problem as their hands are tied to continue to provide content to the end users.) Read between the lines you will understand it will all make sense later.
I will make The Official Public Statement within 24 hours of the FCC Vote. That statement will be how to get involved, help, get us jump started in your area, funding, the ENTIRE details of the plan, goals, and timeline. AS WELL as how to contact us. This will take time and we are not a magic solution that will fix the problem overnight.
We are however THE solution to the underlying problem with ISPs of today. We have been researching for quite a while and digging deep into the entities that have caused us to get where we are now. The further you go digging into 'THEM' the more pissed off you become as you truly realize whats going on and has been on among the ISPs its MUCH deeper than you are being told.
OUR solution will remove all of "them" from the equation completely as well as being faster, and cheaper than the Tier 1 as you wont be paying for the connection or speed, you would be paying for the hardware/overhead cost. AND we will be bringing you closer to the content providers than EVER before.
AND we will be the only solution capable for competing in the current Tier1 Monopoly zones, I promise you they cannot match our plan's price, IF they did it would be only as a loss leader and NOT a sustainable long term solution for those competing with us at are for-profit....
In order for our solution to work, and to keep the internet service non-bias, well non-bias from OUR members :) this will need to be a collective effort, focused one clearly defined vision. WE WILL AND WE MUST ALL set "profits" aside on this as profits in selling nothing other "connection" to the internet has gotten us in the mess we are in now. AND YES we realize profits help maintain and upgrade the infrastructure, BUT that isn't true in this case...Overhead from our view includes those anticipated costs.
Smaller ISPs will need to make a decision, give up profits, become one with us, and be apart of the mission OR they will be left to suffer at the mercy of the ISPs above them setting the cost of bandwidth eventually leading to their demise.
This will happen because we wont be bound by the T1s .... WE would be the "Tier 0" that doesn't exist ;)
This sounds crazy, impossible, BUT its not, it will work WILL happen, regardless of the FCC's vote. as if the FCC choices to keep NN, its only a matter of time till the big lawyers of the ISPs find some loophole, or lobby enough to bring us back to this.
Legistlation is NOT the solution its just a band-aid fix as the cancer continues to grow within.
PLEASE understand that
Until the vote is made, and we release what we are doing, stay put, hang in, it will all be explained later, we are the only true solution.
BIG-ISPs WILL REGRET WHAT THEY HAVE DONE!
What needs to be understood by all is with net neutrality inplace the ability to compete aginst the Tier 1s directly over customers and reinvent the internet to lower or remove costs completely, increase speeds AND expand to underserved/unserved communities ITS NOT POSSIBLE WITH NN
NN REPEAL is the only way to the fixing the problem for good... yes the For profit BIG ISPs will benefit but not forever.. as repealing it opens the doors for outside the box big picture innovators to come in and offer something different, the big ISPs have clearly over looked this small detail being the possibility of a “NonProfit CoOp TIER 1 ISP” entering into the game thru end users and businesses working together as one entity to defeat them... THE FOR PROFIT ISPs over looked this because they are blinded by the profit potential of NN Repeal, never did they consider our option as a possible outcome because no one has attempted it....
We will unite as one
Be the first to know! -stay updated
SnapChat: theqsolution -
Why does snapchat on android suck so badly?
Lemme get this out of me.
They admitted to focusing on the iOS variant more from now on. Why? Becuase it has a larger user base.
That means they will not give many fucks about the ONE BILLION ANDROID USERS.
But about the app itself...
With quite normal usage (let's say around 30 minutes opened in total, daily) snapchat uses more battery than my screen. What the fuck?
It is literally at the very top.
It might go up to 800mAh calculated drain. I don't know how they did it.
Anyways, it doesn't even work well.
It has a lot of lag, crahses, and makes my phone as hot as a cup of tea.
I suspect that's becuase it keeps using the camera. That is, keeps it on even when you are on a different screen. This is bullshit. I do sometimes chat with people on SC but I try to minimise it for this reason.
The UI itself is okayish but still lags beyond comprehension in comparison to other apps (wow, I love the android discord client, it has full functionality at low resource cost).
As far as I'm concerned it uses some sort of web technology mix. It does use chromium so I suspect HTML, CSS and JS is also present in the source code.
Also, let's make this a terrible mobile apps rant - feel free to contribute.4